Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00
PubTator Score 0.29

Knowledge Summary

Patent

No data available

AA Sequence

MPELLVFPAQTDLHEHPLYRAGHLILQDRASCLPAMLLDPRQAPMSWMPVPPQAIKTSHLAALLKNQGKI      1 - 70
FAFDLDARRLASMATLLAWAGVSCCELAEEDFLAVSPLDPRYREVHYVLLDPSCSGSGMPSRQLEEPGAG     71 - 140
TPSPVRLHALAGFQQRALCHALTFPSLQRLVYSMCSLCQEENEDMVQDALQQNPGAFRLAPALPARPHRG    141 - 210
LSTFPGAEHCLRASPKTTLSGGFFVAVIERVEMPTSASQAKASAPERTPSPAPKRKKRAKSCSRCLHTAL    211 - 280
HIAEAPGSLLPGGKGRCLSSPWKTLGPHRRQQFAF                                       281 - 315
//

Text Mined References (8)

PMID Year Title