Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00
PubTator Score 0.29

Knowledge Summary


No data available

AA Sequence

HIAEAPGSLLPGGKGRCLSSPWKTLGPHRRQQFAF                                       281 - 315

Text Mined References (8)

PMID Year Title
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12073013 2002 Identification of additional transcripts in the Williams-Beuren syndrome critical region.
11978965 2001 Characterization of two novel genes, WBSCR20 and WBSCR22, deleted in Williams-Beuren syndrome.