Property Summary

NCBI Gene PubMed Count 20
Grant Count 3
R01 Count 3
Funding $350,912.5
PubMed Score 7.56
PubTator Score 6.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
psoriasis -1.200 0.000
glioblastoma 1.500 0.020
osteosarcoma 1.570 0.000
astrocytoma 2.000 0.011
atypical teratoid / rhabdoid tumor -1.200 0.000
medulloblastoma, large-cell -1.300 0.000
Duchenne muscular dystrophy 1.319 0.000
limb girdle muscular dystrophy 2A 1.013 0.000
non-small cell lung cancer -1.710 0.000
intraductal papillary-mucinous carcinoma... -1.300 0.007
lung cancer -1.800 0.000
colon cancer -2.200 0.000
breast carcinoma -1.400 0.000
adult high grade glioma -1.500 0.000
group 4 medulloblastoma -1.200 0.025
pilocytic astrocytoma 1.100 0.003
non primary Sjogren syndrome sicca 1.200 0.017
subependymal giant cell astrocytoma 2.709 0.001
lung adenocarcinoma -1.700 0.000
lung carcinoma -1.100 0.000
Alzheimer's disease 1.100 0.019
Pick disease 1.200 0.008
ductal carcinoma in situ -1.100 0.008
invasive ductal carcinoma -1.800 0.002
ovarian cancer -2.200 0.000
head and neck cancer -1.300 0.025

Synonym

Accession Q63ZY3 B0I1P4 Q3KQZ3 Q6GUF5 Q9H8S4 Q9NUP0 Q9P210
Symbols SIP
MXRA3
PPKWH
ANKRD25

Gene

PDB

4HBD  

Gene RIF (3)

PMID Text
25961457 identified recessive mutations in kidney ankyrin repeat-containing protein 1 (KANK1), KANK2, and KANK4 in individuals with nephrotic syndrome.
24671081 Using whole-exome sequencing, authors identified a homozygous missense c.2009C>T mutation in KANK2
17476305 SIP, a novel ankyrin repeat containing protein, sequesters steroid receptor coactivators in the cytoplasm.

AA Sequence

MAQVLHVPAPFPGTPGPASPPAFPAKDPDPPYSVETPYGYRLDLDFLKYVDDIEKGHTLRRVAVQRRPRL      1 - 70
SSLPRGPGSWWTSTESLCSNASGDSRHSAYSYCGRGFYPQYGALETRGGFNPRVERTLLDARRRLEDQAA     71 - 140
TPTGLGSLTPSAAGSTASLVGVGLPPPTPRSSGLSTPVPPSAGHLAHVREQMAGALRKLRQLEEQVKLIP    141 - 210
VLQVKLSVLQEEKRQLTVQLKSQKFLGHPTAGRGRSELCLDLPDPPEDPVALETRSVGTWVRERDLGMPD    211 - 280
GEAALAAKVAVLETQLKKALQELQAAQARQADPQPQAWPPPDSPVRVDTVRVVEGPREVEVVASTAAGAP    281 - 350
AQRAQSLEPYGTGLRALAMPGRPESPPVFRSQEVVETMCPVPAAATSNVHMVKKISITERSCDGAAGLPE    351 - 420
VPAESSSSPPGSEVASLTQPEKSTGRVPTQEPTHREPTRQAASQESEEAGGTGGPPAGVRSIMKRKEEVA    421 - 490
DPTAHRRSLQFVGVNGGYESSSEDSSTAENISDNDSTENEAPEPRERVPSVAEAPQLRPAGTAAAKTSRQ    491 - 560
ECQLSRESQHIPTAEGASGSNTEEEIRMELSPDLISACLALEKYLDNPNALTERELKVAYTTVLQEWLRL    561 - 630
ACRSDAHPELVRRHLVTFRAMSARLLDYVVNIADSNGNTALHYSVSHANFPVVQQLLDSGVCKVDKQNRA    631 - 700
GYSPIMLTALATLKTQDDIETVLQLFRLGNINAKASQAGQTALMLAVSHGRVDVVKALLACEADVNVQDD    701 - 770
DGSTALMCACEHGHKEIAGLLLAVPSCDISLTDRDGSTALMVALDAGQSEIASMLYSRMNIKCSFAPMSD    771 - 840
DESPTSSSAEE                                                               841 - 851
//

Publication (28)

PMID Year Title
27161844 2016 Steroid receptor co-activator interacting protein (SIP) mediates EGF-stimulated expression of the prostaglandin synthase COX2 and prostaglandin release in human myometrium.
26739330 2016 Association of liprin ?-1 with kank proteins in melanoma.
25961457 2015 KANK deficiency leads to podocyte dysfunction and nephrotic syndrome.
25416956 2014 A proteome-scale map of the human interactome network.
24671081 2014 Mutation in KANK2, encoding a sequestering protein for steroid receptor coactivators, causes keratoderma and woolly hair.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22371500 2012 Steroid receptor coactivator-interacting protein (SIP) inhibits caspase-independent apoptosis by preventing apoptosis-inducing factor (AIF) from being released from mitochondria.
More...