Property Summary

NCBI Gene PubMed Count 20
PubMed Score 8.39
PubTator Score 6.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (26)

Disease log2 FC p
adult high grade glioma -1.500 2.4e-04
Alzheimer's disease 1.100 1.9e-02
astrocytoma 2.000 1.1e-02
Astrocytoma, Pilocytic 1.100 1.9e-03
atypical teratoid / rhabdoid tumor -1.200 2.1e-04
breast carcinoma -1.400 4.3e-05
colon cancer -2.200 5.7e-06
Duchenne muscular dystrophy 1.319 1.2e-10
ductal carcinoma in situ -1.100 7.9e-03
glioblastoma 1.500 2.0e-02
group 4 medulloblastoma -1.200 2.5e-02
head and neck cancer -1.300 2.5e-02
intraductal papillary-mucinous carcinoma... -1.300 6.8e-03
invasive ductal carcinoma -1.800 1.8e-03
limb girdle muscular dystrophy 2A 1.013 2.5e-07
lung adenocarcinoma -1.700 3.7e-12
lung cancer -1.100 6.9e-03
lung carcinoma -1.100 3.7e-11
medulloblastoma, large-cell -1.300 2.2e-05
non primary Sjogren syndrome sicca 1.200 1.7e-02
non-small cell lung cancer -1.710 3.1e-18
osteosarcoma 1.570 3.9e-06
ovarian cancer -2.200 2.4e-09
Pick disease 1.200 8.3e-03
psoriasis -1.200 9.2e-07
subependymal giant cell astrocytoma 2.709 1.3e-03

Gene RIF (4)

AA Sequence

MAQVLHVPAPFPGTPGPASPPAFPAKDPDPPYSVETPYGYRLDLDFLKYVDDIEKGHTLRRVAVQRRPRL      1 - 70
SSLPRGPGSWWTSTESLCSNASGDSRHSAYSYCGRGFYPQYGALETRGGFNPRVERTLLDARRRLEDQAA     71 - 140
TPTGLGSLTPSAAGSTASLVGVGLPPPTPRSSGLSTPVPPSAGHLAHVREQMAGALRKLRQLEEQVKLIP    141 - 210
VLQVKLSVLQEEKRQLTVQLKSQKFLGHPTAGRGRSELCLDLPDPPEDPVALETRSVGTWVRERDLGMPD    211 - 280
GEAALAAKVAVLETQLKKALQELQAAQARQADPQPQAWPPPDSPVRVDTVRVVEGPREVEVVASTAAGAP    281 - 350
AQRAQSLEPYGTGLRALAMPGRPESPPVFRSQEVVETMCPVPAAATSNVHMVKKISITERSCDGAAGLPE    351 - 420
VPAESSSSPPGSEVASLTQPEKSTGRVPTQEPTHREPTRQAASQESEEAGGTGGPPAGVRSIMKRKEEVA    421 - 490
DPTAHRRSLQFVGVNGGYESSSEDSSTAENISDNDSTENEAPEPRERVPSVAEAPQLRPAGTAAAKTSRQ    491 - 560
ECQLSRESQHIPTAEGASGSNTEEEIRMELSPDLISACLALEKYLDNPNALTERELKVAYTTVLQEWLRL    561 - 630
ACRSDAHPELVRRHLVTFRAMSARLLDYVVNIADSNGNTALHYSVSHANFPVVQQLLDSGVCKVDKQNRA    631 - 700
GYSPIMLTALATLKTQDDIETVLQLFRLGNINAKASQAGQTALMLAVSHGRVDVVKALLACEADVNVQDD    701 - 770
DGSTALMCACEHGHKEIAGLLLAVPSCDISLTDRDGSTALMVALDAGQSEIASMLYSRMNIKCSFAPMSD    771 - 840
DESPTSSSAEE                                                               841 - 851
//

Text Mined References (28)

PMID Year Title