Property Summary

NCBI Gene PubMed Count 7
PubMed Score 185.94
PubTator Score 8.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 3.23520153564882E-23
adrenocortical carcinoma 1427 1.37342602228728E-10
breast carcinoma 1614 5.0786789254417E-5
medulloblastoma, large-cell 6234 1.31218162196498E-4
non-inflammatory breast cancer 208 3.61719816828036E-4
invasive ductal carcinoma 2950 5.55079089614195E-4
posterior fossa group B ependymoma 1530 0.00128796050113719
cystic fibrosis 1670 0.0014792083210151
ductal carcinoma in situ 1745 0.00156774819795179
group 4 medulloblastoma 1875 0.0213078230567456
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (10)

Synonym

Accession Q63HQ2 A8K6D7 Q5U643 Q6P3V1 Q8N124 Q8N197 Q8N7Y0 Q8N8N5 Q8NAL2
Symbols PIKA
AGRNL
AGRINL

Gene

  Ortholog (8)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (1)

PMID Text
19727342 Strong candidate gene for macular dystrophy, MCDR3 (human 5p15.33-p13.1). Conclusion is based on a massive expression data set for mouse (103 strains) and joint analysis of RetNet database.

AA Sequence

MDLIRGVLLRLLLLASSLGPGAVSLRAAIRKPGKVGPPLDIKLGALNCTAFSIQWKMPRHPGSPILGYTV      1 - 70
FYSEVGADKSLQEQLHSVPLSRDIPTTEEVIGDLKPGTEYRVSIAAYSQAGKGRLSSPRHVTTLSQDSCL     71 - 140
PPAAPQQPHVIVVSDSEVALSWKPGASEGSAPIQYYSVEFIRPDFDKKWTSIHERIQMDSMVIKGLDPDT    141 - 210
NYQFAVRAMNSHGPSPRSWPSDIIRTLCPEEAGSGRYGPRYITDMGAGEDDEGFEDDLDLDISFEEVKPL    211 - 280
PATKGGNKKFLVESKKMSISNPKTISRLIPPTSASLPVTTVAPQPIPIQRKGKNGVAIMSRLFDMPCDET    281 - 350
LCSADSFCVNDYTWGGSRCQCTLGKGGESCSEDIVIQYPQFFGHSYVTFEPLKNSYQAFQITLEFRAEAE    351 - 420
DGLLLYCGENEHGRGDFMSLAIIRRSLQFRFNCGTGVAIIVSETKIKLGGWHTVMLYRDGLNGLLQLNNG    421 - 490
TPVTGQSQGQYSKITFRTPLYLGGAPSAYWLVRATGTNRGFQGCVQSLAVNGRRIDMRPWPLGKALSGAD    491 - 560
VGECSSGICDEASCIHGGTCTAIKADSYICLCPLGFKGRHCEDAFTLTIPQFRESLRSYAATPWPLEPQH    561 - 630
YLSFMEFEITFRPDSGDGVLLYSYDTGSKDFLSINLAGGHVEFRFDCGSGTGVLRSEDPLTLGNWHELRV    631 - 700
SRTAKNGILQVDKQKIVEGMAEGGFTQIKCNTDIFIGGVPNYDDVKKNSGVLKPFSGSIQKIILNDRTIH    701 - 770
VKHDFTSGVNVENAAHPCVRAPCAHGGSCRPRKEGYDCDCPLGFEGLHCQKECGNYCLNTIIEAIEIPQF    771 - 840
IGRSYLTYDNPDILKRVSGSRSNVFMRFKTTAKDGLLLWRGDSPMRPNSDFISLGLRDGALVFSYNLGSG    841 - 910
VASIMVNGSFNDGRWHRVKAVRDGQSGKITVDDYGARTGKSPGMMRQLNINGALYVGGMKEIALHTNRQY    911 - 980
MRGLVGCISHFTLSTDYHISLVEDAVDGKNINTCGAK                                     981 - 1017
//

Text Mined References (10)

PMID Year Title
22760553 2012 Genome-wide pharmacogenomic study of citalopram-induced side effects in STAR*D.
21129441 2011 Pikachurin interaction with dystroglycan is diminished by defective O-mannosyl glycosylation in congenital muscular dystrophy models and rescued by LARGE overexpression.
20078962 2009 [Model of aberrant DNA methylation patterns and its applications in epithelial ovarian cancer.].
19727342 2009 Gene expression in the mouse eye: an online resource for genetics using 103 strains of mice.
18641643 2008 Pikachurin, a dystroglycan ligand, is essential for photoreceptor ribbon synapse formation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.