Property Summary

NCBI Gene PubMed Count 8
PubMed Score 207.87
PubTator Score 8.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adrenocortical carcinoma -1.213 1.4e-10
breast carcinoma -1.800 5.1e-05
cystic fibrosis 1.400 1.5e-03
ductal carcinoma in situ -1.100 1.6e-03
group 3 medulloblastoma 1.300 5.9e-03
inflammatory breast cancer -1.400 5.6e-04
invasive ductal carcinoma -1.715 6.1e-04
lung carcinoma 1.400 3.2e-23
medulloblastoma, large-cell 1.500 1.3e-04
posterior fossa group B ependymoma 1.100 1.3e-03

Gene RIF (2)

AA Sequence

MDLIRGVLLRLLLLASSLGPGAVSLRAAIRKPGKVGPPLDIKLGALNCTAFSIQWKMPRHPGSPILGYTV      1 - 70
FYSEVGADKSLQEQLHSVPLSRDIPTTEEVIGDLKPGTEYRVSIAAYSQAGKGRLSSPRHVTTLSQDSCL     71 - 140
PPAAPQQPHVIVVSDSEVALSWKPGASEGSAPIQYYSVEFIRPDFDKKWTSIHERIQMDSMVIKGLDPDT    141 - 210
NYQFAVRAMNSHGPSPRSWPSDIIRTLCPEEAGSGRYGPRYITDMGAGEDDEGFEDDLDLDISFEEVKPL    211 - 280
PATKGGNKKFLVESKKMSISNPKTISRLIPPTSASLPVTTVAPQPIPIQRKGKNGVAIMSRLFDMPCDET    281 - 350
LCSADSFCVNDYTWGGSRCQCTLGKGGESCSEDIVIQYPQFFGHSYVTFEPLKNSYQAFQITLEFRAEAE    351 - 420
DGLLLYCGENEHGRGDFMSLAIIRRSLQFRFNCGTGVAIIVSETKIKLGGWHTVMLYRDGLNGLLQLNNG    421 - 490
TPVTGQSQGQYSKITFRTPLYLGGAPSAYWLVRATGTNRGFQGCVQSLAVNGRRIDMRPWPLGKALSGAD    491 - 560
VGECSSGICDEASCIHGGTCTAIKADSYICLCPLGFKGRHCEDAFTLTIPQFRESLRSYAATPWPLEPQH    561 - 630
YLSFMEFEITFRPDSGDGVLLYSYDTGSKDFLSINLAGGHVEFRFDCGSGTGVLRSEDPLTLGNWHELRV    631 - 700
SRTAKNGILQVDKQKIVEGMAEGGFTQIKCNTDIFIGGVPNYDDVKKNSGVLKPFSGSIQKIILNDRTIH    701 - 770
VKHDFTSGVNVENAAHPCVRAPCAHGGSCRPRKEGYDCDCPLGFEGLHCQKECGNYCLNTIIEAIEIPQF    771 - 840
IGRSYLTYDNPDILKRVSGSRSNVFMRFKTTAKDGLLLWRGDSPMRPNSDFISLGLRDGALVFSYNLGSG    841 - 910
VASIMVNGSFNDGRWHRVKAVRDGQSGKITVDDYGARTGKSPGMMRQLNINGALYVGGMKEIALHTNRQY    911 - 980
MRGLVGCISHFTLSTDYHISLVEDAVDGKNINTCGAK                                     981 - 1017
//

Text Mined References (11)

PMID Year Title