Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q63HN1 Q6ZRJ7
Symbols FAM205B
C9orf144

Gene

 Compartment GO Term (0)

AA Sequence

MHPMALHMVLPAHLPFLSPEVLRLLEVHVKKWMHFQRWGLPRRVEESLRQLMPNPPLYYQPGNDQPVSFN      1 - 70
LNNTSQVSLHRSETISLQTWCSCVAGQPIQTFWVSEWSTMNPEQRHHCQQTPNPMALALPSPALKALSGP     71 - 140
HPQSGGQDNDSGSDLQQKYSQLFCGLPSLHSESLVATFMGSQGLPKIENVPKPPLKDPFLFNDLSFPQLL    141 - 210
PKTSPQSAPPSSPLSPNWVSPSDHQRAQINVPFLTLAEYEALEWHLLQRQLQLQWGWPAALQRSQHTQCL    211 - 280
MQHEPCGKAQSPETTTASQTGKSISVLTRELLFFPEHARKLLEFHIQKQSIRHRWGLPQKIQQSIQLLLT    281 - 350
STDQQTVSSSSTALANVSIPQPVALEANGACDVLSPIAAPVSIPRPHLLTQVKAILQSHIDSKCGQIHQG    351 - 420
KIPACVHRSWDCRISGVLAVAPFPCIPESQFLVLQTASDPDLHHKVMPWMPTALDQQQQALPGTVTEHPK    421 - 490
LLRVLSVEAIEKLETTLRHKHLAFLSGLPALYYVALPRALAPAVTSQSVITEMEPSPVEIPAEPLI        491 - 556
//

Text Mined References (3)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.