Property Summary

NCBI Gene PubMed Count 2
PubMed Score 2.96
PubTator Score 1.88

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
27055460 We found no supportive evidence that PLCXD3 variants are associated with sporadic Creutzfeldt-Jakob disease.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MASSQGKNELKLADWMATLPESMHSIPLTNLAIPGSHDSFSFYIDEASPVGPEQPETVQNFVSVFGTVAK      1 - 70
KLMRKWLATQTMNFTGQLGAGIRYFDLRISTKPRDPDNELYFAHGLFSAKVNEGLEEINAFLTDHHKEVV     71 - 140
FLDFNHFYGMQKYHHEKLVQMLKDIYGNKMCPAIFAQEVSLKYLWEKDYQVLVFYHSPVALEVPFLWPGQ    141 - 210
MMPAPWANTTDPEKLIQFLQASITERRKKGSFFISQVVLTPKASTVVKGVASGLRETITERALPAMMQWV    211 - 280
RTQKPGESGINIVTADFVELGDFISTVIKLNYVFDEGEANT                                 281 - 321
//

Text Mined References (5)

PMID Year Title
27055460 2016 Variants of PLCXD3 are not associated with variant or sporadic Creutzfeldt-Jakob disease in a large international study.
22732399 2012 Cloning, tissue distribution and sub-cellular localisation of phospholipase C X-domain containing protein (PLCXD) isoforms.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.