Property Summary

NCBI Gene PubMed Count 2
PubMed Score 2.97
PubTator Score 1.88

Knowledge Summary


No data available


  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma -2.076 1.0e-02
adult high grade glioma -2.700 2.6e-04
astrocytoma -1.300 3.6e-11
atypical teratoid / rhabdoid tumor -3.700 1.6e-12
cystic fibrosis -2.300 3.5e-05
ependymoma -2.300 4.0e-06
glioblastoma -3.100 2.5e-09
group 4 medulloblastoma -1.500 3.3e-02
intraductal papillary-mucinous adenoma (... -1.100 1.6e-02
intraductal papillary-mucinous carcinoma... -1.100 2.7e-02
intraductal papillary-mucinous neoplasm ... -1.700 4.7e-03
invasive ductal carcinoma -1.100 9.8e-03
lung adenocarcinoma -1.300 8.7e-21
medulloblastoma, large-cell -3.800 1.6e-06
oligodendroglioma -2.000 4.2e-02
osteosarcoma -2.258 6.5e-04
ovarian cancer -1.100 2.6e-04
pituitary cancer -3.400 3.6e-05
primitive neuroectodermal tumor -2.700 4.0e-03

Gene RIF (2)

AA Sequence

RTQKPGESGINIVTADFVELGDFISTVIKLNYVFDEGEANT                                 281 - 321

Text Mined References (5)

PMID Year Title