Property Summary

NCBI Gene PubMed Count 2
PubMed Score 2.96
PubTator Score 1.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung adenocarcinoma 2714 8.74505954999794E-21
atypical teratoid / rhabdoid tumor 4369 1.62361881622791E-12
astrocytoma 1493 3.58416411793859E-11
posterior fossa group A ependymoma 1511 1.95740841088699E-7
glioblastoma 5572 2.56874248109466E-7
pediatric high grade glioma 2712 4.56506268786284E-7
medulloblastoma, large-cell 6234 1.62510007991421E-6
cystic fibrosis 1670 3.52077993910064E-6
pituitary cancer 1972 3.58877303861617E-5
ovarian cancer 8492 2.64704788701073E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 4.93974081310239E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 6.17038755551727E-4
osteosarcoma 7933 6.49172412797343E-4
primitive neuroectodermal tumor 3031 0.00404964739159829
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00471793642638338
invasive ductal carcinoma 2950 0.00984021232741208
adrenocortical carcinoma 1427 0.00999688186274164
group 4 medulloblastoma 1875 0.0327540775788287
oligodendroglioma 2849 0.0422931246386069
Disease Target Count Z-score Confidence
Variant Creutzfeldt-Jakob disease 17 3.149 1.6

Expression

Synonym

Accession Q63HM9 A6NL04
Symbols

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Fruitfly EggNOG Inparanoid

Gene RIF (2)

PMID Text
27055460 We found no supportive evidence that PLCXD3 variants are associated with sporadic Creutzfeldt-Jakob disease.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MASSQGKNELKLADWMATLPESMHSIPLTNLAIPGSHDSFSFYIDEASPVGPEQPETVQNFVSVFGTVAK      1 - 70
KLMRKWLATQTMNFTGQLGAGIRYFDLRISTKPRDPDNELYFAHGLFSAKVNEGLEEINAFLTDHHKEVV     71 - 140
FLDFNHFYGMQKYHHEKLVQMLKDIYGNKMCPAIFAQEVSLKYLWEKDYQVLVFYHSPVALEVPFLWPGQ    141 - 210
MMPAPWANTTDPEKLIQFLQASITERRKKGSFFISQVVLTPKASTVVKGVASGLRETITERALPAMMQWV    211 - 280
RTQKPGESGINIVTADFVELGDFISTVIKLNYVFDEGEANT                                 281 - 321
//

Text Mined References (5)

PMID Year Title
27055460 2016 Variants of PLCXD3 are not associated with variant or sporadic Creutzfeldt-Jakob disease in a large international study.
22732399 2012 Cloning, tissue distribution and sub-cellular localisation of phospholipase C X-domain containing protein (PLCXD) isoforms.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.