Property Summary

NCBI Gene PubMed Count 3
PubMed Score 42.67
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Iridocyclitis 12 3.249 1.6
Senile cataract 4 3.153 1.6

Expression

Synonym

Accession Q63HM1 A2RUB3 KFA
Symbols KF
FKF
KFA

Gene

PANTHER Protein Class (2)

Gene RIF (1)

PMID Text
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MMDVSGVGFPSKVPWKKMSAEELENQYCPSRWVVRLGAEEALRTYSQIGIEATTRARATRKSLLHVPYGD      1 - 70
GEGEKVDIYFPDESSEALPFFLFFHGGYWQSGSKDESAFMVHPLTAQGVAVVIVAYGIAPKGTLDHMVDQ     71 - 140
VTRSVAFVQKRYPSNKGIYLCGHSAGAHLAAMMLLADWTKHGVTPNLRGFFLVSGVFDLEPIVYTSQNVA    141 - 210
LQLTLEDAQRNSPQLKVAQAQPVDPTCRVLVVVGQFDSPEFHRQSWEFYQTLCQGEWKASFEELHDVDHF    211 - 280
EIVENLTQKDNVLTQIILKTIFQ                                                   281 - 303
//

Text Mined References (5)

PMID Year Title
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14704851 2004 Enzymology of NAD+ homeostasis in man.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.