Property Summary

NCBI Gene PubMed Count 98
PubMed Score 785.54
PubTator Score 144.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.500 2.0e-04
Breast cancer 1.100 9.5e-04
COPD -1.300 8.9e-03
glioblastoma 1.200 7.0e-06
group 3 medulloblastoma 1.600 4.2e-05
osteosarcoma 1.454 2.0e-04
pediatric high grade glioma 1.700 4.7e-04
primary pancreatic ductal adenocarcinoma 1.230 3.3e-02
primitive neuroectodermal tumor 1.300 9.2e-05
subependymal giant cell astrocytoma 1.669 1.2e-02

 GO Function (1)

Gene RIF (83)

AA Sequence

MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLT      1 - 70
DTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAA     71 - 140
PYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRV    141 - 210
VLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQ    211 - 280
LNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSA    281 - 350
AVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLF    351 - 420
DVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWR    421 - 490
KIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA                              491 - 534
//

Text Mined References (103)

PMID Year Title