Property Summary

NCBI Gene PubMed Count 85
Grant Count 704
R01 Count 422
Funding $69,594,776.01
PubMed Score 733.89
PubTator Score 144.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Synonym

Accession Q5ZPR3 Q6P5Y4 Q6UXI2 Q8NBI8 Q8NC34 Q8NCB6 Q9BXR1
Symbols B7H3
B7-H3
B7RP-2
4Ig-B7-H3

Gene

 GO Function (1)

Gene RIF (70)

PMID Text
26823710 Suggesting that B7-H3 and Tregs may act cooperatively in tumor immune evasion, leading to poor outcomes for NSCLC patients.
26702052 findings demonstrate that activation-induced B7-H3 expression on synovial monocytes has the potential to inhibit Th1-mediated immune responses and immunomodulatory roles affecting RA pathogenesis.
26438868 found that the N-glycans of B7-H3 from Ca9-22 oral cancer cells contain the terminal alpha-galactose and are more diverse with higher fucosylation and better interaction with DC-SIGN and Langerin on immune cells than that from normal cells
26376842 B7-H3 is one of the most strongly expressed B7-family molecules in AML and merits further investigation.
26151358 B7H3 promotes cell migration and invasion through the Jak2/Stat3/MMP9 signaling pathway in colorectal cancer
26149216 Data show that immunoglobulin-like transcript 4 (ILT4) increases the expression of the co-inhibitory molecule B7-H3 through PI3K/AKT/mTOR signalling.
26108069 B7-H3 may play an important role in asthma exacerbation and was a useful clinical biomarker to evaluate asthma exacerbation.
25931383 B7-H3 was significantly up-regulated on monocytes in rheumatoid arthritis patients, while soluble B7-H3 in serum was decreased. A polymorphism variant, B7-H3-T-A-C-T, was shown to be associated with the incidence of RA and the decreased release of sB7-H3.
25872657 Study shows that B7-H3 promotes mantle cell lymphoma progression and its knockdown significantly enhances the chemosensitivity.
25684945 The overexpression of B7-H3 induces resistance to apoptosis in colorectal cancer cell lines by upregulating the Jak2-STAT3 signaling pathway.
More...

AA Sequence

MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLT      1 - 70
DTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAA     71 - 140
PYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRV    141 - 210
VLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQ    211 - 280
LNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSA    281 - 350
AVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLF    351 - 420
DVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWR    421 - 490
KIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA                              491 - 534
//

Text Mined References (90)

PMID Year Title
26823710 2015 B7-H3 in combination with regulatory T cell is associated with tumor progression in primary human non-small cell lung cancer.
26702052 2016 Preferential Induction of the T Cell Auxiliary Signaling Molecule B7-H3 on Synovial Monocytes in Rheumatoid Arthritis.
26438868 2015 Glycoprotein B7-H3 overexpression and aberrant glycosylation in oral cancer and immune response.
26376842 2015 B7-H3 protein expression in acute myeloid leukemia.
26151358 2015 B7?H3 promotes cell migration and invasion through the Jak2/Stat3/MMP9 signaling pathway in colorectal cancer.
26149216 2015 ILT4 drives B7-H3 expression via PI3K/AKT/mTOR signalling and ILT4/B7-H3 co-expression correlates with poor prognosis in non-small cell lung cancer.
26108069 B7-H3 expression in children with asthma exacerbation.
25931383 2015 Correlation between B7-H3 expression and rheumatoid arthritis: A new polymorphism haplotype is associated with increased disease risk.
25872657 2015 B7-H3 silencing inhibits tumor progression of mantle cell lymphoma and enhances chemosensitivity.
25684945 2015 Overexpression of B7-H3 augments anti-apoptosis of colorectal cancer cells by Jak2-STAT3.
More...