Property Summary

NCBI Gene PubMed Count 85
PubMed Score 733.89
PubTator Score 144.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Liver carcinoma 217
Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 3.24294054156743E-11
osteosarcoma 7933 3.37826445153552E-7
group 4 medulloblastoma 1875 3.78589190910691E-5
primitive neuroectodermal tumor 3031 9.22230179278768E-5
pediatric high grade glioma 2712 4.66479282650122E-4
Breast cancer 3099 9.45460876389407E-4
glioblastoma 5572 0.00544972797435109
COPD 116 0.00889928873188789
subependymal giant cell astrocytoma 2287 0.0115237725352416
primary pancreatic ductal adenocarcinoma 1271 0.0327901690215456

Expression

  Differential Expression (10)

Synonym

Accession Q5ZPR3 Q6P5Y4 Q6UXI2 Q8NBI8 Q8NC34 Q8NCB6 Q9BXR1
Symbols B7H3
B7-H3
B7RP-2
4Ig-B7-H3

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse EggNOG Inparanoid
Rat EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Anole lizard EggNOG Inparanoid
Xenopus EggNOG Inparanoid

 GO Function (1)

Gene RIF (70)

PMID Text
26823710 Suggesting that B7-H3 and Tregs may act cooperatively in tumor immune evasion, leading to poor outcomes for NSCLC patients.
26702052 findings demonstrate that activation-induced B7-H3 expression on synovial monocytes has the potential to inhibit Th1-mediated immune responses and immunomodulatory roles affecting RA pathogenesis.
26438868 found that the N-glycans of B7-H3 from Ca9-22 oral cancer cells contain the terminal alpha-galactose and are more diverse with higher fucosylation and better interaction with DC-SIGN and Langerin on immune cells than that from normal cells
26376842 B7-H3 is one of the most strongly expressed B7-family molecules in AML and merits further investigation.
26151358 B7H3 promotes cell migration and invasion through the Jak2/Stat3/MMP9 signaling pathway in colorectal cancer
26149216 Data show that immunoglobulin-like transcript 4 (ILT4) increases the expression of the co-inhibitory molecule B7-H3 through PI3K/AKT/mTOR signalling.
26108069 B7-H3 may play an important role in asthma exacerbation and was a useful clinical biomarker to evaluate asthma exacerbation.
25931383 B7-H3 was significantly up-regulated on monocytes in rheumatoid arthritis patients, while soluble B7-H3 in serum was decreased. A polymorphism variant, B7-H3-T-A-C-T, was shown to be associated with the incidence of RA and the decreased release of sB7-H3.
25872657 Study shows that B7-H3 promotes mantle cell lymphoma progression and its knockdown significantly enhances the chemosensitivity.
25684945 The overexpression of B7-H3 induces resistance to apoptosis in colorectal cancer cell lines by upregulating the Jak2-STAT3 signaling pathway.
More...

AA Sequence

MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLT      1 - 70
DTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAA     71 - 140
PYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRV    141 - 210
VLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQ    211 - 280
LNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSA    281 - 350
AVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLF    351 - 420
DVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWR    421 - 490
KIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA                              491 - 534
//

Text Mined References (90)

PMID Year Title
26823710 2015 B7-H3 in combination with regulatory T cell is associated with tumor progression in primary human non-small cell lung cancer.
26702052 2016 Preferential Induction of the T Cell Auxiliary Signaling Molecule B7-H3 on Synovial Monocytes in Rheumatoid Arthritis.
26438868 2015 Glycoprotein B7-H3 overexpression and aberrant glycosylation in oral cancer and immune response.
26376842 2015 B7-H3 protein expression in acute myeloid leukemia.
26151358 2015 B7?H3 promotes cell migration and invasion through the Jak2/Stat3/MMP9 signaling pathway in colorectal cancer.
26149216 2015 ILT4 drives B7-H3 expression via PI3K/AKT/mTOR signalling and ILT4/B7-H3 co-expression correlates with poor prognosis in non-small cell lung cancer.
26108069 B7-H3 expression in children with asthma exacerbation.
25931383 2015 Correlation between B7-H3 expression and rheumatoid arthritis: A new polymorphism haplotype is associated with increased disease risk.
25872657 2015 B7-H3 silencing inhibits tumor progression of mantle cell lymphoma and enhances chemosensitivity.
25684945 2015 Overexpression of B7-H3 augments anti-apoptosis of colorectal cancer cells by Jak2-STAT3.
More...