Property Summary

NCBI Gene PubMed Count 121
Grant Count 54
R01 Count 32
Funding $6,467,172.45
PubMed Score 362.26
PubTator Score 233.44

Knowledge Summary

Patent (6,833)

Expression

  Differential Expression (13)

 GWAS Trait (1)

Gene RIF (110)

PMID Text
26867653 DOG1 was expressed in 66% of CD117(+) GISTs and highly associated with tumor size and the rate of wild-type tumors
26808319 TCGA analysis showed that ANO1 and FADD, located at 11q13, were co-expressed at transcript level and significantly associated with overall and disease-free survival
26678977 DOG1 positivity in select non-GIST tumors.
26563938 Data show that calcium-activated chloride channel TMEM16 overexpression correlates with decreased survival in human papilloma virus -negative tumors.
26542395 PKCalpha is coupled to ATP-stimulated TMEM16A activation in biliary epithelial cells.
26510736 ANO1 on ICCs makes a key contribution to generation and regulation of pacemaker electrical slow-wave activity.
26498851 ANO1 expression and gene amplification showed no significant associations with clinicopathological parameters in HNSCC.
26481648 Our results indicated that both the electrical property and the size of the side-chain at residue 447 have significant effects on Ca(2+) dependent gating of TMEM16A.
26464669 DOG1 is a sensitive marker in the diagnosis of acinic cell carcinoma
26429157 DOG-1, VEGFA and p16 are expressed in cutaneous basal and squamous cell carcinomas
More...

AA Sequence

MRVNEKYSTLPAEDRSVHIINICAIEDIGYLPSEGTLLNSLSVDPDAECKYGLYFRDGRRKVDYILVYHH      1 - 70
KRPSGNRTLVRRVQHSDTPSGARSVKQDHPLPGKGASLDAGSGEPPMDYHEDDKRFRREEYEGNLLEAGL     71 - 140
ELERDEDTKIHGVGFVKIHAPWNVLCREAEFLKLKMPTKKMYHINETRGLLKKINSVLQKITDPIQPKVA    141 - 210
EHRPQTMKRLSYPFSREKQHLFDLSDKDSFFDSKTRSTIVYEILKRTTCTKAKYSMGITSLLANGVYAAA    211 - 280
YPLHDGDYNGENVEFNDRKLLYEEWARYGVFYKYQPIDLVRKYFGEKIGLYFAWLGVYTQMLIPASIVGI    281 - 350
IVFLYGCATMDENIPSMEMCDQRHNITMCPLCDKTCSYWKMSSACATARASHLFDNPATVFFSVFMALWA    351 - 420
ATFMEHWKRKQMRLNYRWDLTGFEEEEEAVKDHPRAEYEARVLEKSLKKESRNKEKRRHIPEESTNKWKQ    421 - 490
RVKTAMAGVKLTDKVKLTWRDRFPAYLTNLVSIIFMIAVTFAIVLGVIIYRISMAAALAMNSSPSVRSNI    491 - 560
RVTVTATAVIINLVVIILLDEVYGCIARWLTKIEVPKTEKSFEERLIFKAFLLKFVNSYTPIFYVAFFKG    561 - 630
RFVGRPGDYVYIFRSFRMEECAPGGCLMELCIQLSIIMLGKQLIQNNLFEIGIPKMKKLIRYLKLKQQSP    631 - 700
PDHEECVKRKQRYEVDYNLEPFAGLTPEYMEMIIQFGFVTLFVASFPLAPLFALLNNIIEIRLDAKKFVT    701 - 770
ELRRPVAVRAKDIGIWYNILRGIGKLAVIINAFVISFTSDFIPRLVYLYMYSKNGTMHGFVNHTLSSFNV    771 - 840
SDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKYDISKDFWAVLAARLAFVIVFQNLVMFMSDFVDW    841 - 910
VIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETWMEKERQKDEPPCNHHNTKACPDSLGSPAPSHA    911 - 980
YHGGVL                                                                    981 - 986
//

Text Mined References (134)

PMID Year Title
26867653 2016 Parallelism of DOG1 expression with recurrence risk in gastrointestinal stromal tumors bearing KIT or PDGFRA mutations.
26808319 2016 Meta-Analyses of Microarray Datasets Identifies ANO1 and FADD as Prognostic Markers of Head and Neck Cancer.
26678977 2015 Is DOG1 Immunoreactivity Specific to Gastrointestinal Stromal Tumor?
26563938 2015 TMEM16A/ANO1 is differentially expressed in HPV-negative versus HPV-positive head and neck squamous cell carcinoma through promoter methylation.
26542395 2016 PKC? regulates TMEM16A-mediated Cl? secretion in human biliary cells.
26510736 2016 Use of anoctamin 1 (ANO1) to evaluate interstitial cells of Cajal in Hirschsprung's disease.
26498851 2015 Clinical significance of Anoctamin-1 gene at 11q13 in the development and progression of head and neck squamous cell carcinomas.
26481648 2015 Molecular simulation assisted identification of Ca(2+) binding residues in TMEM16A.
26464669 2015 Diagnostic role of DOG1 and p63 immunohistochemistry in salivary gland carcinomas.
26429157 2015 Correlation of angiogenesis with other immunohistochemical markers in cutaneous basal and squamous cell carcinomas.
More...