Property Summary

Ligand Count 13
NCBI Gene PubMed Count 138
PubMed Score 414.39
PubTator Score 233.44

Knowledge Summary

Patent (6,833)

Expression

  Differential Expression (13)

Disease log2 FC p
Breast cancer -2.400 2.4e-07
breast carcinoma -1.400 1.6e-12
cutaneous lupus erythematosus -1.100 1.1e-02
Endometriosis 1.085 1.7e-02
esophageal adenocarcinoma 1.300 2.1e-02
intraductal papillary-mucinous adenoma (... -1.400 4.2e-02
intraductal papillary-mucinous neoplasm ... 1.900 2.8e-02
ovarian cancer 1.300 8.5e-03
pancreatic cancer 2.300 5.5e-05
primary pancreatic ductal adenocarcinoma 1.600 8.7e-03
psoriasis -1.100 5.7e-05
ulcerative colitis 1.200 6.2e-03
uncontrolled asthma 1.900 2.2e-04

Gene RIF (127)

AA Sequence

MRVNEKYSTLPAEDRSVHIINICAIEDIGYLPSEGTLLNSLSVDPDAECKYGLYFRDGRRKVDYILVYHH      1 - 70
KRPSGNRTLVRRVQHSDTPSGARSVKQDHPLPGKGASLDAGSGEPPMDYHEDDKRFRREEYEGNLLEAGL     71 - 140
ELERDEDTKIHGVGFVKIHAPWNVLCREAEFLKLKMPTKKMYHINETRGLLKKINSVLQKITDPIQPKVA    141 - 210
EHRPQTMKRLSYPFSREKQHLFDLSDKDSFFDSKTRSTIVYEILKRTTCTKAKYSMGITSLLANGVYAAA    211 - 280
YPLHDGDYNGENVEFNDRKLLYEEWARYGVFYKYQPIDLVRKYFGEKIGLYFAWLGVYTQMLIPASIVGI    281 - 350
IVFLYGCATMDENIPSMEMCDQRHNITMCPLCDKTCSYWKMSSACATARASHLFDNPATVFFSVFMALWA    351 - 420
ATFMEHWKRKQMRLNYRWDLTGFEEEEEAVKDHPRAEYEARVLEKSLKKESRNKEKRRHIPEESTNKWKQ    421 - 490
RVKTAMAGVKLTDKVKLTWRDRFPAYLTNLVSIIFMIAVTFAIVLGVIIYRISMAAALAMNSSPSVRSNI    491 - 560
RVTVTATAVIINLVVIILLDEVYGCIARWLTKIEVPKTEKSFEERLIFKAFLLKFVNSYTPIFYVAFFKG    561 - 630
RFVGRPGDYVYIFRSFRMEECAPGGCLMELCIQLSIIMLGKQLIQNNLFEIGIPKMKKLIRYLKLKQQSP    631 - 700
PDHEECVKRKQRYEVDYNLEPFAGLTPEYMEMIIQFGFVTLFVASFPLAPLFALLNNIIEIRLDAKKFVT    701 - 770
ELRRPVAVRAKDIGIWYNILRGIGKLAVIINAFVISFTSDFIPRLVYLYMYSKNGTMHGFVNHTLSSFNV    771 - 840
SDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKYDISKDFWAVLAARLAFVIVFQNLVMFMSDFVDW    841 - 910
VIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETWMEKERQKDEPPCNHHNTKACPDSLGSPAPSHA    911 - 980
YHGGVL                                                                    981 - 986
//

Text Mined References (151)

PMID Year Title