Property Summary

NCBI Gene PubMed Count 121
PubMed Score 362.26
PubTator Score 233.44

Knowledge Summary

Patent (6,833)

Expression

  Differential Expression (13)

Disease log2 FC p
esophageal adenocarcinoma 1.300 2.1e-02
uncontrolled asthma 1.900 2.2e-04
psoriasis 1.700 1.3e-04
cutaneous lupus erythematosus -1.100 1.1e-02
primary pancreatic ductal adenocarcinoma 1.600 8.7e-03
intraductal papillary-mucinous adenoma (... -1.400 4.2e-02
intraductal papillary-mucinous neoplasm ... 1.900 2.8e-02
pancreatic cancer 2.300 5.5e-05
Endometriosis 1.085 1.7e-02
Breast cancer -3.000 3.5e-09
breast carcinoma -1.400 1.6e-12
ulcerative colitis 1.200 6.2e-03
ovarian cancer 1.300 8.5e-03

 GWAS Trait (1)

Gene RIF (110)

PMID Text
26867653 DOG1 was expressed in 66% of CD117(+) GISTs and highly associated with tumor size and the rate of wild-type tumors
26808319 TCGA analysis showed that ANO1 and FADD, located at 11q13, were co-expressed at transcript level and significantly associated with overall and disease-free survival
26678977 DOG1 positivity in select non-GIST tumors.
26563938 Data show that calcium-activated chloride channel TMEM16 overexpression correlates with decreased survival in human papilloma virus -negative tumors.
26542395 PKCalpha is coupled to ATP-stimulated TMEM16A activation in biliary epithelial cells.
26510736 ANO1 on ICCs makes a key contribution to generation and regulation of pacemaker electrical slow-wave activity.
26498851 ANO1 expression and gene amplification showed no significant associations with clinicopathological parameters in HNSCC.
26481648 Our results indicated that both the electrical property and the size of the side-chain at residue 447 have significant effects on Ca(2+) dependent gating of TMEM16A.
26464669 DOG1 is a sensitive marker in the diagnosis of acinic cell carcinoma
26429157 DOG-1, VEGFA and p16 are expressed in cutaneous basal and squamous cell carcinomas
26359375 A novel exon in the human Ca2+-activated Cl- channel Ano1 imparts greater sensitivity to intracellular calcium.
26313899 Anoctamin and pendrin are two plausible candidates as mediators of apical iodide efflux--{review}
26305547 our findings provide evidence that ANO1 overexpression contributes to tumor growth and invasion of lung cancer; and suppressing ANO1 overexpression may have therapeutic potential in lung cancer therapy
26272691 Aberrant c-KIT and DOG-1 expressions in CRC are rare events, either in NMA or MA.
26191287 gastrointestinal stromal tumors with mutations in the DOG1 gene were not found
26153424 ANO1 is essential for the development of prostate hyperplasia.
26135531 DOG1 expression was found in low-grade fibromyxoid sarcoma, highlighting the potential for diagnostic confusion with gastrointestinal stromal tumors.
26077572 TMEM16A and myocardin form a positive feedback loop that is disrupted by KLF5 during Ang II-induced vascular remodeling.
25973067 Report endothelial cell pathology and DOG-1 expression in liposarcomas versus non-lipomatous soft tissue tumors.
25914185 examined TMEM16A protein interactions with calmodulin and CaMKIIdelta likely cause efflux of chloride, thus resulting in increased vascular resistance by increasing vascular wall tone in long-standing hypertension
25839162 TMEM16A overexpression promotes invasion and metastasis in gastric cancer.
25823819 ANO1 and EGFR form a functional complex that jointly regulates head & neck squamous cell carcinoma cell proliferation.
25781344 Data show that calcium-activated chloride channel regulator 1 (CLCA1) and transmembrane protein 16A (TMEM16A) co-localize and physically interact and that CLCA1 increases the level of TMEM16A protein at the cell surface.
25770012 This is the first demonstration that the TMEM16A-NF-kappaB pathway is positively involved in IL-13-induced mucus production, which provides novel insight into the molecular mechanism of mucin overproduction.
25632981 DOG1 immunocytochemistry can serve as a valuable adjunct for the preoperative diagnosis and confirmation of metastasis of Gastrointestinal Stromal Tumors.
25541940 Results indicate that TMEM16A is involved in growth, migration and invasion of metastatic colorectal cancer cells.
25489088 results reveal multidimensional regulation of TMEM16A/16B by preassociated apoCaM and introduce ChIMP as a versatile tool to probe the macromolecular complex and function of Ca(2+)-activated chloride channels
25425649 The novel ANO1 mutants reported have diverse functional characteristics, providing new tools to study ANO1 function in biological systems, paving the path for a better understanding of the function of ANO1 and its role in health and diseases.
25385647 Knockdown of ANO1 expression caused decreased insulin secretion in human islets, establishing a physical proximity-dependent feedback loop involving INS transcription
25351986 The ANO1 promoter region contains putative binding sites for multiple transcription factors including signal transducer and activator of transcription 6 (STAT6), a downstream effector of IL-4.
25298423 Data suggest that ANO1 is responsible for most of the iodide efflux across the apical membrane of thyroid cells.
25232193 Inhibition of histone deacetylase results in a downregulation of TMEM16A expression in tumor cells.
25220078 various TMEM16A isoforms contribute to sweat gland-specific Cl(-) secretion
25163766 Pancreatic ductal adenocarcinoma cell lines showed an upregulation of ANO1 on mRNA and protein levels. ANO1 is the main constituent of CaCC current in PDAC cells.
24980701 analysis of how TMEM16a calcium binding sits are critical for its activity
24928056 ANO1 is present in human myometrium.
24919570 Together, our results identify TMEM16A as a primary driver of the "Grow" or "Go" model for cancer progression, in which TMEM16A expression acts to balance tumor proliferation and metastasis via its promoter methylation.
24913262 TMEM16a is a Ca(2+) -activated Cl(-) channel expressed in the collecting ducts.
24901998 The first intracellular loop of D452, E464, E470, and E475 is critical for voltage- and calcium-dependent gating of Ano1.
24825187 investigated whether DOG1 plays a role in cell migration, apoptosis, proliferation and viability in gastrointestinal stromal tumors
24639373 Clarification of the reasons in future will avail to make ANO1 as a target for cancer treatment.
24599954 results provide an impetus for gaining a deeper understanding of ANO1 modulation in cells and introduce a new targeting approach for antitumor therapy in ANO1-amplified cancers.
24509911 physical and functional interactions between TRPV4 and ANO1 can modulate water transport in the choroid plexus
24478309 TMEM16A and -16F use a similar mechanism for sorting to plasma membrane and protein stabilization, but their functional domains significantly differ
24412532 ANO1 contributes to calcium-dependent chloride channels current in human cardiac fibroblasts and that this is regulated by Ang II acting via the AT1 receptor pathway.
24401903 TMEM16A regulated the expression of NFkappaBmediated genes, including cyclin D1, cyclin E and cmyc, involved in cell proliferation, and matrix metalloproteinases (MMPs)2 and MMP9, which are associated with the migration and invasion of glioma cells.
24379641 Case Report: immunohistochemical staining for DOG1, in addition to gene analysis, is useful for the diagnosis of KIT-negative tumors that are suspected to be gastrointestinal stromal tumors.
24316695 ANO1 could represent a new diagnostic biomarker and a potentially important therapeutic target of oral squamous cell carcinoma.
24243583 The evidence of a sublayer of ANO1 myenteric interstitial cells of Cajal (ICCs) is suggestive for a subpopulation of ICCs being qualified for pacemaking at this early developmental stage.
24167264 Purified and reconstituted TMEM16A is necessary and sufficient to recapitulate the properties of native and heterologously expressed calcium-activated chloride currents.
24152967 Calcium-activated chloride secretion by anoctamin 1 appears to be a crucial component of renal cyst growth.
24080196 ANO1 decreased activity and expression is associated with abnormal cystic fibrosis airway epithelial repair.
23997176 These findings demonstrate that multiple members of this recently described family of CaCCs are expressed in HASM cells, they display classic electrophysiological properties of CaCCs, and they modulate contractile tone in airway smooth muscle.
23994600 The use of an alternative translation start codon appears to occur in a naturally-occurring TMEM16A isoform that is particularly expressed in human testis.
23866066 As the different TMEM16A isoforms do not affect proliferation or migration and do not associate with tumors, our results suggest that the resulting channel activities are not directly involved in cell growth and motility.
23862765 DOG-1 is a biomarker with higher sensitivity and specificity for diagnosis of gastrointestinal stromal tumors.
23722018 Results suggest the usefulness of DOG1 expression as a prognostic tool in gastrointestinal stromal tumors.
23576756 Channels in the TMEM16 family share a homodimeric architecture important for channel assembly, and facilitated by their cytoplasmic N termini.
23576565 Data suggest that insulin-like growth factor-binding protein 5 (IGFBP5) regulation by calcium-dependent chloride channel DOG1.
23570556 The third intracellular loop of calcium activated chloride channel TMEM16A is the site involved in calcium-sensitivity.
23431153 the involvement of the ANO1 chloride channel in tumor progression and provide insights into oncogenic signaling in human cancers with 11q13 amplification
23218903 We present two gastric gastrointestinal stromal tumors which showed loss of DOG-1 in the epithelioid component but retained its expression in the minor spindle cell component.
23104560 These studies represent the initial characterization of mechanosensitive Cl(-) currents mediated by TMEM16A
23038686 Uterine leiomyosarcomas should be added to the list of mesenchymal neoplasms which may be DOG1 positive.
23034390 augmented Cl(Ca)/TMEM16A channel activity is a major contributor to the changes in electromechanical coupling of pulmonary artery in this model of pulmonary hypertension.
22988141 Association of TMEM16A chloride channel overexpression with airway goblet cell metaplasia
22973054 Inducible expression of either CFTR or the calcium-activated chloride channel TMEM16A attenuated the proinflammatory cytokines interleukin-6 (IL-6), IL-8, and CXCL1/2 in two human respiratory epithelial models.
22946960 These data indicate that TMEM16A is the target for INO-4995, although the mode of action appears different for overexpressed and endogenous channels. INO-4995 may be useful for the treatment of CF lung disease.
22946562 These data provide evidence for a functional role of TMEM16A in the vasoconstrictor responses of murine thoracic aorta and mesenteric artery as well as human resistance vessels.
22912841 Enhanced expression of ANO1 in head and neck squamous cell carcinoma causes cell migration and correlates with poor prognosis.
22699056 Aberrant expression of TMEM16A occurs in the majority of gastric carcinoma cases.
22685202 Ano1, ezrin, and moesin/radixin colocalize apically in salivary gland epithelial cells, and overexpression of moesin and Ano1 in HEK cells alters the subcellular localization of both proteins
22571292 DOG-1 is a highly sensitive and specific marker for GISTs and also highlights hitherto unrecognized and unusual patterns of expression in non-mesenchymal neoplasms.
22564524 TMEM16A-induced cancer cell proliferation and tumor growth were accompanied by an increase in extracellular signal-regulated kinase (ERK)1/2 activation and cyclin D1 induction
22526416 [REVIEW] The human ANO1 gene contains four alternatively spliced segments (designated a, b, c and d) which are not predicted to alter the overall membrane topology but change the biophysical properties of the resulting channels.
22495382 seldom expressed and not useful in the evaluation of pancreatic neoplasms
22460810 DOG1 staining is a marker of salivary acinar and to a lesser extent intercalated duct differentiation.
22415075 the regulation of anion fluxes in insulin-producing cells may involve both SLC4A4 and TMEM16A
22399613 c-KIT, PKC-theta; and DOG-1 antigens are the most sensitive and specific immunomarkers for confirming EGISTs
22351639 TMEM16A mRNA and protein expression was increased by EGF to 256 +/- 38% (n = 7; P < 0.01) and 297 +/- 46% (n = 9, P < 0.001) of control levels, respectively.
22335248 demonstrated nests of membranous DOG1(+) chondroblasts located within cellular portions of chondroblastoma containing diffuse heterogeneous infiltrates of mostly DOG1(-) chondroblasts, CD163(+) macrophages and multinucleated osteoclastic giant cells
22197035 The most sensitive marker for gastrointestinal stromal tumors was CD117, followed by DOG-1 and PKCtheta.
22178883 TMEM16A-currents were attenuated by additional expression of CFTR, and were completely abrogated when additionally expressed CFTR was activated by IBMX and forskolin.
21965629 Findings indicate that ANO1 Ca2+-activated Cl- channels of ICC are activated during cholinergic neurotransmission and contribute to the excitatory motor control of motility in the jejunum.
21940901 Ano1 regulates proliferation at the G(1)/S transition of the cell cycle and may play a role in tumorigenesis.
21756825 The expression of DOG-1 was elevated in gastrointestinal stromal tumors.
21645494 an isoform of the TMEM16A protein is associated with chloride channel activity
21585622 Data suggest that Ano1 is a reliable and sensitive marker for interstitial cells of Cajal, and that labeling with antibodies selective for Ano1 reproducibly detects depletion of Kit-positive cells in patients with slow transit constipation.
21358619 Both DOG1 and PKC-theta; can be used in the diagnosis of KIT-negative GISTs.
21350101 DOG1 antibody is a highly sensitive and specific marker for gastrointestinal stromal tumors in cytology cell blocks.
21349842 important changes in expression and splicing of Ano1 in patients with diabetic gastroparesis that alter the electrophysiological properties of the channel.
21295818 Discovered on gastrointestinal stromal tumor 1 (DOG1) is expressed in pancreatic centroacinar cells and in solid-pseudopapillary neoplasms.
21092923 variant was a leucine-to-arginine substitution in the DUF 590 domain of a 16K transmembrane protein, a putative calcium-activated chloride channel encoded by anoctamin 10
21084298 TMEM16A inhibitors reveal TMEM16A as a minor component of calcium-activated chloride channel conductance in airway and intestinal epithelial cells.
21041307 TMEM16A is the operative channel and contributes to Ca(2+)-activated Cl(-) secretion in response to extracellular nucleotides
20716168 In the majority of histologically suspected GISTs a combination of CD117 and DOG1 immunostaining is sufficient to confirm the histological diagnosis.
20716167 Compared with CD117, DOG1 (using the K9 antibody) is a more specific marker, whereas PKC theta (using the clone 27 antibody) is a considerably less specific immunohistochemical marker for GIST.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19823864 Data demonstrate that bestrophin 1 is localized in the endoplasmic reticulum (ER), where it interacts with the ER-Ca(2+) sensor and can enhance Ca(2+) signaling and activation of Ca(2+)-dependent Cl(-) (TMEM16A) and K(+) (SK4) channels.
19819874 Data show that alternative splicing appears as an important mechanism to regulate the voltage and Ca(2+) dependence of the TMEM16A-dependent Cl(-) channels in a tissue-specific manner.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19687122 Anoctin 1 (Ano1) was observed in specialized populations of cells with the morphologies of all classes of Interstitial cells of Cajal. Data suggest a novel role for ANO1 Cl- channels in the generation of slow waves in gastrointestinal muscles.
19654323 TMEM16 proteins appear to be a crucial component of epithelial volume-regulated Cl(-) channels and may also have a function during proliferation and apoptotic cell death
19606013 DOG1 should be added into the diagnostic panel evaluating GI and other abdominal tumors, but limitations in its sensitivity and specificity should be recognized.
19372102 Ano1 labels all classes of interstitial cells of Cajal (ICC) and represents a highly specific marker for studying the distribution of ICC in mouse and human gastrointestinal tissues.
19011564 DOG1.1 is a sensitive immunohistochemical marker for gastrointestinal stromal tumors
18772398 results indicate that TMEM16A is an intrinsic constituent of the calcium-dependent chloride channel
18648740 Based on four cases, the DOG1 gene was found not to be mutated in gastrointestinal stromal tumors.
12739008 This gene, located within the CCND1-EMS1 locus on human chromosome 11q13, encodes the eight-transmembrane protein homologous to C12orf3, C11orf25 and FLJ34272 gene products and is amplified in various cancers

AA Sequence

MRVNEKYSTLPAEDRSVHIINICAIEDIGYLPSEGTLLNSLSVDPDAECKYGLYFRDGRRKVDYILVYHH      1 - 70
KRPSGNRTLVRRVQHSDTPSGARSVKQDHPLPGKGASLDAGSGEPPMDYHEDDKRFRREEYEGNLLEAGL     71 - 140
ELERDEDTKIHGVGFVKIHAPWNVLCREAEFLKLKMPTKKMYHINETRGLLKKINSVLQKITDPIQPKVA    141 - 210
EHRPQTMKRLSYPFSREKQHLFDLSDKDSFFDSKTRSTIVYEILKRTTCTKAKYSMGITSLLANGVYAAA    211 - 280
YPLHDGDYNGENVEFNDRKLLYEEWARYGVFYKYQPIDLVRKYFGEKIGLYFAWLGVYTQMLIPASIVGI    281 - 350
IVFLYGCATMDENIPSMEMCDQRHNITMCPLCDKTCSYWKMSSACATARASHLFDNPATVFFSVFMALWA    351 - 420
ATFMEHWKRKQMRLNYRWDLTGFEEEEEAVKDHPRAEYEARVLEKSLKKESRNKEKRRHIPEESTNKWKQ    421 - 490
RVKTAMAGVKLTDKVKLTWRDRFPAYLTNLVSIIFMIAVTFAIVLGVIIYRISMAAALAMNSSPSVRSNI    491 - 560
RVTVTATAVIINLVVIILLDEVYGCIARWLTKIEVPKTEKSFEERLIFKAFLLKFVNSYTPIFYVAFFKG    561 - 630
RFVGRPGDYVYIFRSFRMEECAPGGCLMELCIQLSIIMLGKQLIQNNLFEIGIPKMKKLIRYLKLKQQSP    631 - 700
PDHEECVKRKQRYEVDYNLEPFAGLTPEYMEMIIQFGFVTLFVASFPLAPLFALLNNIIEIRLDAKKFVT    701 - 770
ELRRPVAVRAKDIGIWYNILRGIGKLAVIINAFVISFTSDFIPRLVYLYMYSKNGTMHGFVNHTLSSFNV    771 - 840
SDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKYDISKDFWAVLAARLAFVIVFQNLVMFMSDFVDW    841 - 910
VIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETWMEKERQKDEPPCNHHNTKACPDSLGSPAPSHA    911 - 980
YHGGVL                                                                    981 - 986
//

Text Mined References (134)

PMID Year Title
26867653 2016 Parallelism of DOG1 expression with recurrence risk in gastrointestinal stromal tumors bearing KIT or PDGFRA mutations.
26808319 2016 Meta-Analyses of Microarray Datasets Identifies ANO1 and FADD as Prognostic Markers of Head and Neck Cancer.
26678977 2015 Is DOG1 Immunoreactivity Specific to Gastrointestinal Stromal Tumor?
26563938 2015 TMEM16A/ANO1 is differentially expressed in HPV-negative versus HPV-positive head and neck squamous cell carcinoma through promoter methylation.
26542395 2016 PKC? regulates TMEM16A-mediated Cl? secretion in human biliary cells.
26510736 2016 Use of anoctamin 1 (ANO1) to evaluate interstitial cells of Cajal in Hirschsprung's disease.
26498851 2015 Clinical significance of Anoctamin-1 gene at 11q13 in the development and progression of head and neck squamous cell carcinomas.
26481648 2015 Molecular simulation assisted identification of Ca(2+) binding residues in TMEM16A.
26464669 2015 Diagnostic role of DOG1 and p63 immunohistochemistry in salivary gland carcinomas.
26429157 2015 Correlation of angiogenesis with other immunohistochemical markers in cutaneous basal and squamous cell carcinomas.
26359375 2015 A novel exon in the human Ca2+-activated Cl- channel Ano1 imparts greater sensitivity to intracellular Ca2.
26313899 2015 Pendrin and anoctamin as mediators of apical iodide efflux in thyroid cells.
26305547 2015 Inhibition of Calcium-Activated Chloride Channel ANO1/TMEM16A Suppresses Tumor Growth and Invasion in Human Lung Cancer.
26272691 2015 Aberrant expressions of c-KIT and DOG-1 in mucinous and nonmucinous colorectal carcinomas and relation to clinicopathologic features and prognosis.
26191287 2015 Presence of PDGFRA and DOG1 mutations in gastrointestinal stromal tumors among Chinese population.
26153424 2015 Anoctamin 1 (TMEM16A) is essential for testosterone-induced prostate hyperplasia.
26135531 2015 DOG1 Expression in Low-Grade Fibromyxoid Sarcoma: A Study of 11 Cases, With Molecular Characterization.
26077572 2015 TMEM16A and myocardin form a positive feedback loop that is disrupted by KLF5 during Ang II-induced vascular remodeling.
25973067 2015 Relationship of endothelial area with VEGF-A, COX-2, maspin, c-KIT, and DOG-1 immunoreactivity in liposarcomas versus non-lipomatous soft tissue tumors.
25914185 2015 Alterations of TMEM16a allostery in human retinal microarterioles in long-standing hypertension.
25839162 2015 TMEM16A overexpression contributes to tumor invasion and poor prognosis of human gastric cancer through TGF-? signaling.
25823819 2015 ANO1/TMEM16A interacts with EGFR and correlates with sensitivity to EGFR-targeting therapy in head and neck cancer.
25781344 2015 Secreted CLCA1 modulates TMEM16A to activate Ca(2+)-dependent chloride currents in human cells.
25770012 2015 TMEM16A mediates the hypersecretion of mucus induced by Interleukin-13.
25632981 2015 Utility of DOG1 Immunomarker in Fine Needle Aspirates of Gastrointestinal Stromal Tumor.
25541940 2014 Inhibition of TMEM16A expression suppresses growth and invasion in human colorectal cancer cells.
25489088 2014 Preassociated apocalmodulin mediates Ca2+-dependent sensitization of activation and inactivation of TMEM16A/16B Ca2+-gated Cl- channels.
25425649 2015 Variomics screen identifies the re-entrant loop of the calcium-activated chloride channel ANO1 that facilitates channel activation.
25385647 2014 Mapping of long-range INS promoter interactions reveals a role for calcium-activated chloride channel ANO1 in insulin secretion.
25351986 2015 Identification and characterization of a novel promoter for the human ANO1 gene regulated by the transcription factor signal transducer and activator of transcription 6 (STAT6).
25298423 2014 Anoctamin-1/TMEM16A is the major apical iodide channel of the thyrocyte.
25232193 2014 Downregulation of Ca2+-activated Cl- channel TMEM16A by the inhibition of histone deacetylase in TMEM16A-expressing cancer cells.
25220078 2014 A novel TMEM16A splice variant lacking the dimerization domain contributes to calcium-activated chloride secretion in human sweat gland epithelial cells.
25201006 2014 Anoctamin 1 is apically expressed on thyroid follicular cells and contributes to ATP- and calcium-activated iodide efflux.
25163766 2015 ANO1 (TMEM16A) in pancreatic ductal adenocarcinoma (PDAC).
24980701 2014 A comprehensive search for calcium binding sites critical for TMEM16A calcium-activated chloride channel activity.
24928056 2014 Calcium-activated chloride channels anoctamin 1 and 2 promote murine uterine smooth muscle contractility.
24919570 2014 To "grow" or "go": TMEM16A expression as a switch between tumor growth and metastasis in SCCHN.
24913262 2014 TMEM16A is a Ca(2+) -activated Cl(-) channel expressed in the renal collecting duct.
24901998 2014 Acidic amino acids in the first intracellular loop contribute to voltage- and calcium- dependent gating of anoctamin1/TMEM16A.
24885604 2014 CFTR and Anoctamin 1 (ANO1) contribute to cAMP amplified exocytosis and insulin secretion in human and murine pancreatic beta-cells.
24825187 2014 Functional role of the Ca²?-activated Cl? channel DOG1/TMEM16A in gastrointestinal stromal tumor cells.
24692353 2014 Structure and function of TMEM16 proteins (anoctamins).
24639373 2014 The Ca(2+) -activated Cl(-) channel, ANO1 (TMEM16A), is a double-edged sword in cell proliferation and tumorigenesis.
24599954 2014 Small molecule-facilitated degradation of ANO1 protein: a new targeting approach for anticancer therapeutics.
24509911 2014 Modulation of water efflux through functional interaction between TRPV4 and TMEM16A/anoctamin 1.
24478309 2014 Functional swapping between transmembrane proteins TMEM16A and TMEM16F.
24412532 2014 ANO1 contributes to angiotensin-II-activated Ca2+-dependent Cl- current in human atrial fibroblasts.
24401903 2014 Transmembrane protein with unknown function 16A overexpression promotes glioma formation through the nuclear factor-?B signaling pathway.
24379641 2013 DOG1 is useful for diagnosis of KIT-negative gastrointestinal stromal tumor of stomach.
24316695 2014 ANO1 as a marker of oral squamous cell carcinoma and silencing ANO1 suppresses migration of human SCC-25 cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24243583 2014 Anoctamin 1 positive esophageal interstitial Cajal cells in late stage human embryos.
24167264 2013 Purified TMEM16A is sufficient to form Ca2+-activated Cl- channels.
24152967 2014 Anoctamin 1 induces calcium-activated chloride secretion and proliferation of renal cyst-forming epithelial cells.
24080196 2013 Anoctamin 1 dysregulation alters bronchial epithelial repair in cystic fibrosis.
23997176 2013 Functional expression of the TMEM16 family of calcium-activated chloride channels in airway smooth muscle.
23994600 2014 Non-canonical translation start sites in the TMEM16A chloride channel.
23866066 2013 TMEM16A alternative splicing coordination in breast cancer.
23862765 2013 Diagnostic significance of DOG-1 and PKC-? expression and c-Kit/PDGFRA mutations in gastrointestinal stromal tumours.
23722018 2013 Contribution of DOG1 expression to the diagnosis of gastrointestinal stromal tumors.
23576756 2013 Identification of a dimerization domain in the TMEM16A calcium-activated chloride channel (CaCC).
23576565 2013 DOG1 regulates growth and IGFBP5 in gastrointestinal stromal tumors.
23570556 2013 TMEM16A-TMEM16B chimaeras to investigate the structure-function relationship of calcium-activated chloride channels.
23431153 2013 Calcium-activated chloride channel ANO1 promotes breast cancer progression by activating EGFR and CAMK signaling.
23218903 2013 Loss of DOG-1 expression associated with shift from spindled to epithelioid morphology in gastric gastrointestinal stromal tumors with KIT and platelet-derived growth factor receptor ? mutations.
23104560 2013 Mechanosensitive Cl- secretion in biliary epithelium mediated through TMEM16A.
23038686 2013 DOG1 immunoreactivity in uterine leiomyosarcomas.
23034390 2012 Increased TMEM16A-encoded calcium-activated chloride channel activity is associated with pulmonary hypertension.
22988141 2012 Association of TMEM16A chloride channel overexpression with airway goblet cell metaplasia.
22973054 2012 Proinflammatory cytokine secretion is suppressed by TMEM16A or CFTR channel activity in human cystic fibrosis bronchial epithelia.
22946960 2013 Control of TMEM16A by INO-4995 and other inositolphosphates.
22946562 2013 Potent vasorelaxant activity of the TMEM16A inhibitor T16A(inh) -A01.
22946059 2012 Anoctamins are a family of Ca2+-activated Cl- channels.
22912841 2012 Enhanced expression of ANO1 in head and neck squamous cell carcinoma causes cell migration and correlates with poor prognosis.
22699056 2012 [Expression of TMEM16A in gastric carcinoma and its clinical implications].
22685202 2012 Anoctamin 1 (Tmem16A) Ca2+-activated chloride channel stoichiometrically interacts with an ezrin-radixin-moesin network.
22571292 2012 Discovered on gastrointestinal stromal tumours 1 (DOG1) expression in non-gastrointestinal stromal tumour (GIST) neoplasms.
22564524 2012 TMEM16A induces MAPK and contributes directly to tumorigenesis and cancer progression.
22526416 2012 Ca2+-activated Cl- channels at a glance.
22495382 2012 DOG1 (clone K9) is seldom expressed and not useful in the evaluation of pancreatic neoplasms.
22460810 2012 DOG1: a novel marker of salivary acinar and intercalated duct differentiation.
22415075 2012 Expression of TMEM16A and SLC4A4 in human pancreatic islets.
22399613 2012 Diagnostic relevance of overexpressions of PKC-? and DOG-1 and KIT/PDGFRA gene mutations in extragastrointestinal stromal tumors: a Korean six-centers study of 28 cases.
22351639 2012 Epidermal growth factor chronically upregulates Ca(2+)-dependent Cl(-) conductance and TMEM16A expression in intestinal epithelial cells.
22335248 2012 Discovered on gastrointestinal stromal tumour 1 (DOG1): a useful immunohistochemical marker for diagnosing chondroblastoma.
22302790 2012 The anoctamin (TMEM16) gene family: calcium-activated chloride channels come of age.
22197035 2012 Gastrointestinal stromal tumors (GISTs): CD117, DOG-1 and PKC? expression. Is there any advantage in using several markers?
22178883 2011 CFTR and TMEM16A are separate but functionally related Cl- channels.
21984732 2012 The anoctamin family: TMEM16A and TMEM16B as calcium-activated chloride channels.
21965629 2011 ANO1-ther brick in the wall--role of Ca2+-activated Cl- channels of interstitial cells of Cajal in cholinergic motor control of gastrointestinal smooth muscle.
21940901 2011 Ano1 as a regulator of proliferation.
21908539 2012 Expression and function of epithelial anoctamins.
21756825 2011 [Expression of DOG-1 in gastrointestinal stromal tumor and its diagnostic application].
21645494 2011 A minimal isoform of the TMEM16A protein associated with chloride channel activity.
21642943 2011 Physiological roles and diseases of Tmem16/Anoctamin proteins: are they all chloride channels?
21607626 2011 Anoctamins.
21585622 2011 Immunoreactivity for Ano1 detects depletion of Kit-positive interstitial cells of Cajal in patients with slow transit constipation.
21358619 2011 DOG1 and PKC-? are useful in the diagnosis of KIT-negative gastrointestinal stromal tumors.
21350101 2011 DOG1 antibody is a highly sensitive and specific marker for gastrointestinal stromal tumors in cytology cell blocks.
21349842 2011 Altered expression of Ano1 variants in human diabetic gastroparesis.
21295818 2011 Discovered on gastrointestinal stromal tumor 1 (DOG1) is expressed in pancreatic centroacinar cells and in solid-pseudopapillary neoplasms--novel evidence for a histogenetic relationship.
21269460 2011 Initial characterization of the human central proteome.
21186280 2010 TMEM16A protein: a new identity for Ca(2+)-dependent Cl? channels.
21092923 2010 Targeted next-generation sequencing of a 12.5 Mb homozygous region reveals ANO10 mutations in patients with autosomal-recessive cerebellar ataxia.
21084298 2011 TMEM16A inhibitors reveal TMEM16A as a minor component of calcium-activated chloride channel conductance in airway and intestinal epithelial cells.
21056985 2011 Characterization of the oligomeric structure of the Ca(2+)-activated Cl- channel Ano1/TMEM16A.
21041307 2011 Identification and functional characterization of TMEM16A, a Ca2+-activated Cl- channel activated by extracellular nucleotides, in biliary epithelium.
20716168 2010 DOG1 and CD117 are the antibodies of choice in the diagnosis of gastrointestinal stromal tumours.
20716167 2010 Specificity of DOG1 (K9 clone) and protein kinase C theta (clone 27) as immunohistochemical markers of gastrointestinal stromal tumour.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20056604 2010 Expression and function of epithelial anoctamins.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19823864 2010 ER-localized bestrophin 1 activates Ca2+-dependent ion channels TMEM16A and SK4 possibly by acting as a counterion channel.
19819874 2009 Regulation of TMEM16A chloride channel properties by alternative splicing.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19687122 2009 Expression of anoctamin 1/TMEM16A by interstitial cells of Cajal is fundamental for slow wave activity in gastrointestinal muscles.
19654323 2009 TMEM16 proteins produce volume-regulated chloride currents that are reduced in mice lacking TMEM16A.
19606013 2009 DOG1 antibody in the differential diagnosis of gastrointestinal stromal tumors: a study of 1840 cases.
19372102 2009 Ano1 is a selective marker of interstitial cells of Cajal in the human and mouse gastrointestinal tract.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19015192 2009 Anoctamin/TMEM16 family members are Ca2+-activated Cl- channels.
19011564 2009 Monoclonal antibody DOG1.1 shows higher sensitivity than KIT in the diagnosis of gastrointestinal stromal tumors, including unusual subtypes.
18772398 2008 TMEM16A, a membrane protein associated with calcium-dependent chloride channel activity.
18724360 2008 TMEM16A confers receptor-activated calcium-dependent chloride conductance.
18648740 2008 Mutation assay of the novel gene DOG1 in gastrointestinal stromal tumors (GISTs).
16906560 2006 Comprehensive genome and transcriptome analysis of the 11q13 amplicon in human oral cancer and synteny to the 7F5 amplicon in murine oral carcinoma.
16261155 2006 Head and neck squamous cell carcinoma transcriptome analysis by comprehensive validated differential display.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15215166 2004 The novel marker, DOG1, is expressed ubiquitously in gastrointestinal stromal tumors irrespective of KIT or PDGFRA mutation status.
15067359 2004 Identification and characterization of TMEM16E and TMEM16F genes in silico.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12739008 2003 FLJ10261 gene, located within the CCND1-EMS1 locus on human chromosome 11q13, encodes the eight-transmembrane protein homologous to C12orf3, C11orf25 and FLJ34272 gene products.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.