Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.58
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 9.8e-49

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.800 9.8e-49

Gene RIF (1)

AA Sequence

MADKVLKEKRKQFIRSVGEGTINGLLGELLETRVLSQEEIEIVKCENATVMDKARALLDSVIRKGAPACQ      1 - 70
ICITYICEEDSHLAGTLGLSAGPTSGNHLTTQDSQIVLPS                                   71 - 110
//

Text Mined References (3)

PMID Year Title