Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.58
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Gene RIF (1)

PMID Text
15383541 INCA is a novel intracellular regulator of procaspase-1 activation, involved in the regulation of pro-IL-1beta processing and its release during inflammation

AA Sequence

MADKVLKEKRKQFIRSVGEGTINGLLGELLETRVLSQEEIEIVKCENATVMDKARALLDSVIRKGAPACQ      1 - 70
ICITYICEEDSHLAGTLGLSAGPTSGNHLTTQDSQIVLPS                                   71 - 110
//

Text Mined References (3)

PMID Year Title
27043298 2016 Molecular basis of caspase-1 polymerization and its inhibition by a new capping mechanism.
23897914 2013 A genome-wide association study (GWAS) for bronchopulmonary dysplasia.
15383541 2004 INCA, a novel human caspase recruitment domain protein that inhibits interleukin-1beta generation.