Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 5.1e-03

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.121 5.1e-03

AA Sequence

MGGCPVRKRRRNGSKEGNHHSTQPKRNKRNPIFQDSQDTEFSWSDNERSSSRINIPERASGPEGNLNQIV      1 - 70
TEPDANFPQFLHEGLSKPVYVINWFMSFGPEIKLNTSQQGRNQAV                              71 - 115
//

Text Mined References (5)

PMID Year Title