Property Summary

NCBI Gene PubMed Count 5
PubMed Score 187.70
PubTator Score 25.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung carcinoma 2843 2.0e-65
adult high grade glioma 3801 1.3e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Skull base meningioma 3 4.098 2.0
Opioid abuse 5 3.602 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
adult high grade glioma 1.400 1.3e-03
lung carcinoma 3.900 2.0e-65

Gene RIF (3)

AA Sequence

MLSHADLLDARLGMKDAAELLGHREAVKCRLGVGGSDPGGHPGDLAPNSDPVEGATLLPGEDITTVGSTP      1 - 70
ASLAVSAKDPDKQPGPQGGPNPSQAGQQQGQQKQKRHRTRFTPAQLNELERSFAKTHYPDIFMREELALR     71 - 140
IGLTESRVQVWFQNRRAKWKKRKKTTNVFRAPGTLLPTPGLPQFPSAAAAAAAAMGDSLCSFHANDTRWA    141 - 210
AAAMPGVSQLPLPPALGRQQAMAQSLSQCSLAAGPPPNSMGLSNSLAGSNGAGLQSHLYQPAFPGMVPAS    211 - 280
LPGPSNVSGSPQLCSSPDSSDVWRGTSIASLRRKALEHTVSMSFT                             281 - 325
//

Text Mined References (6)

PMID Year Title