Property Summary

NCBI Gene PubMed Count 8
PubMed Score 17.47
PubTator Score 2.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
group 4 medulloblastoma -1.100 2.4e-04
osteosarcoma 1.376 3.6e-04
ovarian cancer 2.200 2.1e-07

 GO Process (1)

Gene RIF (4)

AA Sequence

MVARVWSLMRFLIKGSVAGGAVYLVYDQELLGPSDKSQAALQKAGEVVPPAMYQFSQYVCQQTGLQIPQL      1 - 70
PAPPKIYFPIRDSWNAGIMTVMSALSVAPSKAREYSKEGWEYVKARTK                           71 - 118
//

Text Mined References (12)

PMID Year Title