Property Summary

NCBI Gene PubMed Count 6
PubMed Score 16.13
PubTator Score 2.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.376 0.000
group 4 medulloblastoma -1.100 0.000
ovarian cancer 2.200 0.000

Synonym

Accession Q5XKP0 A0A0B4J2A5 K7EKR0 Q86YE5
Symbols P117
QIL1
MIC13

Gene

 GO Process (1)

Gene RIF (1)

PMID Text
25997101 we identified QIL1 (C19orf70) as a novel conserved MICOS subunit.

AA Sequence

MVARVWSLMRFLIKGSVAGGAVYLVYDQELLGPSDKSQAALQKAGEVVPPAMYQFSQYVCQQTGLQIPQL      1 - 70
PAPPKIYFPIRDSWNAGIMTVMSALSVAPSKAREYSKEGWEYVKARTK                           71 - 118
//

Publication (10)

PMID Year Title
27485409 2016 Mitochondrial hepato-encephalopathy due to deficiency of QIL1/MIC13 (C19orf70), a MICOS complex subunit.
26477565 2016 Evolution and structural organization of the mitochondrial contact site (MICOS) complex and the mitochondrial intermembrane space bridging (MIB) complex.
25997101 2015 QIL1 is a novel mitochondrial protein required for MICOS complex stability and cristae morphology.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21269460 2011 Initial characterization of the human central proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.