Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.70
PubTator Score 2.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Expression

  Differential Expression (1)

Disease log2 FC p
non diabetic and post-ischemic heart fai... 1.400 0.003

Synonym

Accession Q5XKL5 Q6V9S5
Symbols

Gene

Gene RIF (1)

PMID Text
14654994 expression pattern of BTBD8 shows it may have a function related to brain development

AA Sequence

MARCGEGSAAPMVLLGSAGVCSKGLQRKGPCERRRLKATVSEQLSQDLLRLLREEFHTDVTFSVGCTLFK      1 - 70
AHKAVLLARVPDFYFHTIGQTSNSLTNQEPIAVENVEALEFRTFLQIIYSSNRNIKNYEEEILRKKIMEI     71 - 140
GISQKQLDISFPKCENSSDCSLQKHEIPEDISDRDDDFISNDNYDLEPASELGEDLLKLYVKPCCPDIDI    141 - 210
FVDGKRFKAHRAILSARSSYFAAMLSGCWAESSQEYVTLQGISHVELNVMMHFIYGGTLDIPDKTNVGQI    211 - 280
LNMADMYGLEGLKEVAIYILRRDYCNFFQKPVPRTLTSILECLIIAHSVGVESLFADCMKWIVKHFARFW    281 - 350
SERSFANIPPEIQKSCLNMLIQSLVSIT                                              351 - 378
//

Publication (6)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14654994 2004 Molecular cloning and characterization of a novel human BTBD8 gene containing double BTB/POZ domains.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.