Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.70
PubTator Score 2.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non diabetic and post-ischemic heart failure 200 0.00301705452064234

Expression

  Differential Expression (1)

Disease log2 FC p
non diabetic and post-ischemic heart fai... 1.400 0.003

Synonym

Accession Q5XKL5 Q6V9S5
Symbols

Gene

  Ortholog (1)

Species Source
Mouse EggNOG Inparanoid

Gene RIF (1)

PMID Text
14654994 expression pattern of BTBD8 shows it may have a function related to brain development

AA Sequence

MARCGEGSAAPMVLLGSAGVCSKGLQRKGPCERRRLKATVSEQLSQDLLRLLREEFHTDVTFSVGCTLFK      1 - 70
AHKAVLLARVPDFYFHTIGQTSNSLTNQEPIAVENVEALEFRTFLQIIYSSNRNIKNYEEEILRKKIMEI     71 - 140
GISQKQLDISFPKCENSSDCSLQKHEIPEDISDRDDDFISNDNYDLEPASELGEDLLKLYVKPCCPDIDI    141 - 210
FVDGKRFKAHRAILSARSSYFAAMLSGCWAESSQEYVTLQGISHVELNVMMHFIYGGTLDIPDKTNVGQI    211 - 280
LNMADMYGLEGLKEVAIYILRRDYCNFFQKPVPRTLTSILECLIIAHSVGVESLFADCMKWIVKHFARFW    281 - 350
SERSFANIPPEIQKSCLNMLIQSLVSIT                                              351 - 378
//

Text Mined References (6)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14654994 2004 Molecular cloning and characterization of a novel human BTBD8 gene containing double BTB/POZ domains.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.