Property Summary

NCBI Gene PubMed Count 8
PubMed Score 5.12
PubTator Score 4.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.400 3.1e-05
Astrocytoma, Pilocytic -1.300 1.2e-07
atypical teratoid / rhabdoid tumor -1.100 2.7e-05
ependymoma -1.400 2.7e-11
glioblastoma -1.500 8.0e-10
lung carcinoma 1.700 1.6e-16
medulloblastoma -1.100 1.1e-05
medulloblastoma, large-cell -1.500 7.6e-04
ovarian cancer -1.100 1.4e-03
primitive neuroectodermal tumor -1.200 7.9e-04

AA Sequence

MRWILCWSLTLCLMAQTALGALHTKRPQVVTKYGTLQGKQMHVGKTPIQVFLGVPFSRPPLGILRFAPPE      1 - 70
PPEPWKGIRDATTYPPGCLQESWGQLASMYVSTRERYKWLRFSEDCLYLNVYAPARAPGDPQLPVMVWFP     71 - 140
GGAFIVGAASSYEGSDLAAREKVVLVFLQHRLGIFGFLSTDDSHARGNWGLLDQMAALRWVQENIAAFGG    141 - 210
DPGNVTLFGQSAGAMSISGLMMSPLASGLFHRAISQSGTALFRLFITSNPLKVAKKVAHLAGCNHNSTQI    211 - 280
LVNCLRALSGTKVMRVSNKMRFLQLNFQRDPEEIIWSMSPVVDGVVIPDDPLVLLTQGKVSSVPYLLGVN    281 - 350
NLEFNWLLPYIMKFPLNRQAMRKETITKMLWSTRTLLNITKEQVPLVVEEYLDNVNEHDWKMLRNRMMDI    351 - 420
VQDATFVYATLQTAHYHRDAGLPVYLYEFEHHARGIIVKPRTDGADHGDEMYFLFGGPFATGLSMGKEKA    421 - 490
LSLQMMKYWANFARTGNPNDGNLPCWPRYNKDEKYLQLDFTTRVGMKLKEKKMAFWMSLYQSQRPEKQRQ    491 - 560
F//

Text Mined References (10)

PMID Year Title