Knowledge Summary

Patent

No data available

Synonym

Accession Q5XG85
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MRKLRLRASNPGPSGAPGTRRHFSTSRGGHHCARRWLRRVRRSRSQTPSCQNLDPNPPIARFLLPLERIS      1 - 70
EVPRRACLHGRDASSVWPPPERSD                                                   71 - 94
//

Text Mined References (2)

PMID Year Title