Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.14
PubTator Score 6.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ependymoma 2514 1.25235663498193E-7
Breast cancer 3099 5.01091803957855E-6
pediatric high grade glioma 2712 1.1776494979242E-5
glioblastoma 5572 1.37297517847292E-4
atypical teratoid / rhabdoid tumor 4369 7.78294906582603E-4
lung cancer 4473 0.00322703534720891

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma 1.600 0.000
glioblastoma 1.600 0.000
atypical teratoid / rhabdoid tumor 1.400 0.001
lung cancer -1.100 0.003
pediatric high grade glioma 1.400 0.000
Breast cancer -1.300 0.000

Synonym

Gene

  Ortholog (5)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid

Gene RIF (2)

PMID Text
21555518 TTC23 is a functional target gene of the BACH1 transcription factor according to ChIP-seq and knockdown analysis in HEK 293 cells.
20200953 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MQESQETHISNHLDEVVAAVSITHRKKFQNKLLQTALFQPPREKLHLCEEKAKSYSNSHEYKQAVHELVR      1 - 70
CVALTRICYGDSHWKLAEAHVNLAQGYLQLKGLSLQAKQHAEKARQILANSIVPPYSENTDVFKFSIELF     71 - 140
HTMGRALLSLQKFKEAAENLTKAERLSKELLQCGRIIKEEWIEIEARIRLSFAQVYQGQKKSKEALSHYQ    141 - 210
AALEYVEISKGETSRECVPILRELAGVEQALGLHDVSINHFLQAHLIILSRSPSQVEAADSAHIVAHAAV    211 - 280
ASGRHEHHDVAEQYFQESMAHLKDSEGMGRTKFLSIQDEFCHFLQMTGQKERATSILRESLEAKVEAFGD    281 - 350
FSPEVAETYRLLGGADLAQGNHSGARKKLKKCLQIQTLLYGPQDKRTLATQQAMGMLSTAPKVASKPRQA    351 - 420
SKAKVAFCTSIPQDTLLGKARPGTTAD                                               421 - 447
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
20200953 2010 Genome-wide pleiotropy of osteoporosis-related phenotypes: the Framingham Study.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.