Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.14
PubTator Score 6.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma 1.400 4.4e-05
atypical teratoid / rhabdoid tumor 1.400 7.8e-04
Breast cancer -1.300 5.0e-06
ependymoma 1.600 1.3e-07
glioblastoma 1.300 1.9e-05
lung cancer -1.100 3.2e-03

Gene RIF (2)

AA Sequence

MQESQETHISNHLDEVVAAVSITHRKKFQNKLLQTALFQPPREKLHLCEEKAKSYSNSHEYKQAVHELVR      1 - 70
CVALTRICYGDSHWKLAEAHVNLAQGYLQLKGLSLQAKQHAEKARQILANSIVPPYSENTDVFKFSIELF     71 - 140
HTMGRALLSLQKFKEAAENLTKAERLSKELLQCGRIIKEEWIEIEARIRLSFAQVYQGQKKSKEALSHYQ    141 - 210
AALEYVEISKGETSRECVPILRELAGVEQALGLHDVSINHFLQAHLIILSRSPSQVEAADSAHIVAHAAV    211 - 280
ASGRHEHHDVAEQYFQESMAHLKDSEGMGRTKFLSIQDEFCHFLQMTGQKERATSILRESLEAKVEAFGD    281 - 350
FSPEVAETYRLLGGADLAQGNHSGARKKLKKCLQIQTLLYGPQDKRTLATQQAMGMLSTAPKVASKPRQA    351 - 420
SKAKVAFCTSIPQDTLLGKARPGTTAD                                               421 - 447
//

Text Mined References (11)

PMID Year Title