Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.93
PubTator Score 7.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
diabetes mellitus 1728 1.5e-03
Disease Target Count Z-score Confidence
Kidney disease 430 0.0 3.0
Disease Target Count Z-score Confidence
Bacterial pneumonia 4 3.223 1.6

Gene RIF (2)

AA Sequence

MSSPQRRKAMPWALSLLLMGFQLLVTYAWCSEEEMGGNNKIVQDPMFLATVEFALNTFNVQSKEEHAYRL      1 - 70
LRVLSSWREDSMDRKWRGKMVFSMNLQLRQTVCRKFEDDIDNCPFQESLELNNVRQGISFPQVHSCGCCM     71 - 140
GCGVGTGAADKAIPRDKGK                                                       141 - 159
//

Text Mined References (9)

PMID Year Title