Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.82
PubTator Score 7.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Gene RIF (2)

PMID Text
23922243 The current report is the first to show the immunomodulatory and antimicrobial functions of rCST9 against Francisella tularensis.
12535658 Data report the cloning of a novel human cystatin-like molecule (CLM) from human bone marrow stromal cell (BMSC) cDNA library.

AA Sequence

MSSPQRRKAMPWALSLLLMGFQLLVTYAWCSEEEMGGNNKIVQDPMFLATVEFALNTFNVQSKEEHAYRL      1 - 70
LRVLSSWREDSMDRKWRGKMVFSMNLQLRQTVCRKFEDDIDNCPFQESLELNNVRQGISFPQVHSCGCCM     71 - 140
GCGVGTGAADKAIPRDKGK                                                       141 - 159
//

Text Mined References (9)

PMID Year Title
23922243 2013 Immunomodulatory and antibacterial effects of cystatin 9 against Francisella tularensis.
20565543 Evolution and human tissue expression of the Cres/Testatin subgroup genes, a reproductive tissue specific subgroup of the type 2 cystatins.
20383146 2010 New loci associated with kidney function and chronic kidney disease.
17903292 2007 A genome-wide association for kidney function and endocrine-related traits in the NHLBI's Framingham Heart Study.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15060002 2004 A genomic analysis of rat proteases and protease inhibitors.
12535658 2003 Molecular cloning and characterization of a novel cystatin-like molecule, CLM, from human bone marrow stromal cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.