Knowledge Summary

Patent

No data available

Synonym

Accession Q5W150
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MDCKSPKRANICPHLPGGGLFSTPPSQAAWRTLLTALCFPGPTCTGPMREGPRAVYNPPRAHRNSSDNCV      1 - 70
MKHLLCAGDKNGTRRHALPSPLEGSFQPGRQIPPPQTPSTDPQTLPLSFRSLLRCHQLCAASLPPSLKLP     71 - 140
//

Text Mined References (2)

PMID Year Title