Knowledge Summary

Patent

No data available

Synonym

Accession Q5W150
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MDCKSPKRANICPHLPGGGLFSTPPSQAAWRTLLTALCFPGPTCTGPMREGPRAVYNPPRAHRNSSDNCV      1 - 70
MKHLLCAGDKNGTRRHALPSPLEGSFQPGRQIPPPQTPSTDPQTLPLSFRSLLRCHQLCAASLPPSLKLP     71 - 140
//

Text Mined References (2)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.