Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.07
PubTator Score 4.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -2.100 0.003
ependymoma -1.900 0.008
oligodendroglioma -1.700 0.007
glioblastoma -2.000 0.000
osteosarcoma 1.573 0.000
sonic hedgehog group medulloblastoma -1.700 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
medulloblastoma, large-cell -1.900 0.000
primitive neuroectodermal tumor -1.200 0.003
non-small cell lung cancer -1.206 0.000
lung adenocarcinoma -1.300 0.000
adult high grade glioma -2.100 0.000
pituitary cancer 1.300 0.000

Synonym

Accession Q5W111 A8K3G1 O60648 Q8TBG8 Q96T69
Symbols CLLD6
C13orf1

Gene

 Compartment GO Term (1)

AA Sequence

MATSVLCCLRCCRDGGTGHIPLKEMPAVQLDTQHMGTDVVIVKNGRRICGTGGCLASAPLHQNKSYFEFK      1 - 70
IQSTGIWGIGVATQKVNLNQIPLGRDMHSLVMRNDGALYHNNEEKNRLPANSLPQEGDVVGITYDHVELN     71 - 140
VYLNGKNMHCPASGIRGTVYPVVYVDDSAILDCQFSEFYHTPPPGFEKILFEQQIF                  141 - 196
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...