Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.07
PubTator Score 4.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung adenocarcinoma 2714 3.85788364757507E-21
non-small cell lung cancer 2798 3.20086229876431E-16
atypical teratoid / rhabdoid tumor 4369 3.29672181620048E-8
osteosarcoma 7933 6.62589549812214E-7
pituitary cancer 1972 3.15330918075399E-6
adult high grade glioma 2148 3.37165265043869E-6
glioblastoma 5572 2.00578132440258E-5
sonic hedgehog group medulloblastoma 1482 3.93967907147486E-5
medulloblastoma, large-cell 6234 4.6235768886966E-5
astrocytic glioma 2241 0.00263625202548285
primitive neuroectodermal tumor 3031 0.00293962471574863
oligodendroglioma 2849 0.00748577322963159
ependymoma 2514 0.00842562413830073
Disease Target Count Z-score Confidence
chronic lymphocytic leukemia 244 3.461 1.7

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -2.100 0.003
ependymoma -1.900 0.008
oligodendroglioma -1.700 0.007
glioblastoma -2.000 0.000
osteosarcoma 1.573 0.000
sonic hedgehog group medulloblastoma -1.700 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
medulloblastoma, large-cell -1.900 0.000
primitive neuroectodermal tumor -1.200 0.003
non-small cell lung cancer -1.206 0.000
lung adenocarcinoma -1.300 0.000
adult high grade glioma -2.100 0.000
pituitary cancer 1.300 0.000

Synonym

Accession Q5W111 A8K3G1 O60648 Q8TBG8 Q96T69
Symbols CLLD6
C13orf1

Gene

  Ortholog (16)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG
Fruitfly EggNOG Inparanoid

 Compartment GO Term (2)

AA Sequence

MATSVLCCLRCCRDGGTGHIPLKEMPAVQLDTQHMGTDVVIVKNGRRICGTGGCLASAPLHQNKSYFEFK      1 - 70
IQSTGIWGIGVATQKVNLNQIPLGRDMHSLVMRNDGALYHNNEEKNRLPANSLPQEGDVVGITYDHVELN     71 - 140
VYLNGKNMHCPASGIRGTVYPVVYVDDSAILDCQFSEFYHTPPPGFEKILFEQQIF                  141 - 196
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...