Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.40
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Gene RIF (3)

AA Sequence

MAPWTLWRCCQRVVGWVPVLFITFVVVWSYYAYVVELCVFTIFGNEENGKTVVYLVAFHLFFVMFVWSYW      1 - 70
MTIFTSPASPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSASKTIRYCEKCQLIKPDRAH     71 - 140
HCSACDSCILKMDHHCPWVNNCVGFSNYKFFLLFLLYSLLYCLFVAATVLEYFIKFWTNELTDTRAKFHV    141 - 210
LFLFFVSAMFFISVLSLFSYHCWLVGKNRTTIESFRAPTFSYGPDGNGFSLGCSKNWRQVFGDEKKYWLL    211 - 280
PIFSSLGDGCSFPTRLVGMDPEQASVTNQNEYARSSGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGI    281 - 350
VKSGTNNHVTVAIEN                                                           351 - 365
//

Text Mined References (15)

PMID Year Title