Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.00
PubTator Score 2.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
primary pancreatic ductal adenocarcinoma 1271 5.50244511785445E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0029084728557671
Rheumatoid Arthritis 1171 0.00564192817038558
primary Sjogren syndrome 789 0.00853093661456544
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0188541718767491
spina bifida 1064 0.0380795667833796
pancreatic cancer 2300 0.042852715388549

Expression

Synonym

Accession Q5W0Z9 A8MTV9 C9JG20 I6L9D4 Q2TB82 Q6NVU8
Symbols DHHC-20
4933421L13Rik

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG

 GWAS Trait (1)

Pathway (1)

Gene RIF (2)

PMID Text
20334580 DHHC20 is a human N-terminal-myristoyl-directed palmitoyl acyltransferase involved in cellular transformation, that may play a role in cancer.
18976975 Knockdown of zinc finger, DHHC-type containing 20 (ZDHHC20) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MAPWTLWRCCQRVVGWVPVLFITFVVVWSYYAYVVELCVFTIFGNEENGKTVVYLVAFHLFFVMFVWSYW      1 - 70
MTIFTSPASPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSASKTIRYCEKCQLIKPDRAH     71 - 140
HCSACDSCILKMDHHCPWVNNCVGFSNYKFFLLFLLYSLLYCLFVAATVLEYFIKFWTNELTDTRAKFHV    141 - 210
LFLFFVSAMFFISVLSLFSYHCWLVGKNRTTIESFRAPTFSYGPDGNGFSLGCSKNWRQVFGDEKKYWLL    211 - 280
PIFSSLGDGCSFPTRLVGMDPEQASVTNQNEYARSSGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGI    281 - 350
VKSGTNNHVTVAIEN                                                           351 - 365
//

Text Mined References (14)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23034182 2012 Analysis of substrate specificity of human DHHC protein acyltransferases using a yeast expression system.
20334580 2010 DHHC20: a human palmitoyl acyltransferase that causes cellular transformation.
19946888 2010 Defining the membrane proteome of NK cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16647879 2006 Intracellular localization and tissue-specific distribution of human and yeast DHHC cysteine-rich domain-containing proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...