Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.00
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
20334580 DHHC20 is a human N-terminal-myristoyl-directed palmitoyl acyltransferase involved in cellular transformation, that may play a role in cancer.
18976975 Knockdown of zinc finger, DHHC-type containing 20 (ZDHHC20) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MAPWTLWRCCQRVVGWVPVLFITFVVVWSYYAYVVELCVFTIFGNEENGKTVVYLVAFHLFFVMFVWSYW      1 - 70
MTIFTSPASPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSASKTIRYCEKCQLIKPDRAH     71 - 140
HCSACDSCILKMDHHCPWVNNCVGFSNYKFFLLFLLYSLLYCLFVAATVLEYFIKFWTNELTDTRAKFHV    141 - 210
LFLFFVSAMFFISVLSLFSYHCWLVGKNRTTIESFRAPTFSYGPDGNGFSLGCSKNWRQVFGDEKKYWLL    211 - 280
PIFSSLGDGCSFPTRLVGMDPEQASVTNQNEYARSSGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGI    281 - 350
VKSGTNNHVTVAIEN                                                           351 - 365
//

Text Mined References (14)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23034182 2012 Analysis of substrate specificity of human DHHC protein acyltransferases using a yeast expression system.
20334580 2010 DHHC20: a human palmitoyl acyltransferase that causes cellular transformation.
19946888 2010 Defining the membrane proteome of NK cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16647879 2006 Intracellular localization and tissue-specific distribution of human and yeast DHHC cysteine-rich domain-containing proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...