Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.24
PubTator Score 2.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
osteosarcoma -3.135 0.000
primary pancreatic ductal adenocarcinoma -1.730 0.001
fibroadenoma 2.100 0.039
interstitial cystitis -1.200 0.005
sonic hedgehog group medulloblastoma -1.100 0.004
lung adenocarcinoma 1.200 0.000
lung carcinoma 1.300 0.000
spina bifida -1.354 0.046
ductal carcinoma in situ 2.500 0.000
invasive ductal carcinoma 1.600 0.017
ovarian cancer 1.700 0.000
pituitary cancer 1.400 0.000
pancreatic cancer -1.900 0.001

Gene RIF (2)

PMID Text
19929093 Observational study of gene-disease association. (HuGE Navigator)
12615066 Expression analysis of the rat BSPRY ortholog and demonstration of its interaction with 14-3-3 proteins.

AA Sequence

MSAEGAEPGPGSGSGPGPGPLCPEHGQALSWFCGSERRPVCAACAGLGGRCRGHRIRRAEERAEELRNKI      1 - 70
VDQCERLQLQSAAITKYVADVLPGKNQRAVSMASAARELVIQRLSLVRSLCESEEQRLLEQVHGEEERAH     71 - 140
QSILTQRVHWAEALQKLDTIRTGLVGMLTHLDDLQLIQKEQEIFERTEEAEGILDPQESEMLNFNEKCTR    141 - 210
SPLLTQLWATAVLGSLSGTEDIRIDERTVSPFLQLSDDRKTLTFSTKKSKACADGPERFDHWPNALAATS    211 - 280
FQNGLHAWMVNVQNSCAYKVGVASGHLPRKGSGSDCRLGHNAFSWVFSRYDQEFRFSHNGQHEPLGLLRG    281 - 350
PAQLGVVLDLQVQELLFYEPASGTVLCAHHVSFPGPLFPVFAVADQTISIVR                      351 - 402
//

Text Mined References (9)

PMID Year Title
19929093 2009 Searching for genes for cleft lip and/or palate based on breakpoint analysis of a balanced translocation t(9;17)(q32;q12).
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12615066 2003 Characterization of zetin 1/rBSPRY, a novel binding partner of 14-3-3 proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11099500 2001 Interaction of the type IIa Na/Pi cotransporter with PDZ proteins.
10978534 2000 BSPRY, a novel protein of the Ro-Ret family.