Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.24
PubTator Score 2.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
ductal carcinoma in situ 2.200 4.8e-04
fibroadenoma 2.100 3.9e-02
interstitial cystitis -1.100 1.1e-03
invasive ductal carcinoma 1.600 1.7e-02
lung adenocarcinoma 1.200 1.3e-04
lung carcinoma 1.300 2.8e-29
osteosarcoma -3.135 4.5e-10
ovarian cancer 1.700 8.2e-09
pancreatic cancer -1.900 1.4e-03
pancreatic ductal adenocarcinoma liver m... 1.004 6.1e-03
pituitary cancer 1.400 7.1e-05
sonic hedgehog group medulloblastoma -1.100 4.0e-03
spina bifida -1.354 4.6e-02

Gene RIF (2)

AA Sequence

MSAEGAEPGPGSGSGPGPGPLCPEHGQALSWFCGSERRPVCAACAGLGGRCRGHRIRRAEERAEELRNKI      1 - 70
VDQCERLQLQSAAITKYVADVLPGKNQRAVSMASAARELVIQRLSLVRSLCESEEQRLLEQVHGEEERAH     71 - 140
QSILTQRVHWAEALQKLDTIRTGLVGMLTHLDDLQLIQKEQEIFERTEEAEGILDPQESEMLNFNEKCTR    141 - 210
SPLLTQLWATAVLGSLSGTEDIRIDERTVSPFLQLSDDRKTLTFSTKKSKACADGPERFDHWPNALAATS    211 - 280
FQNGLHAWMVNVQNSCAYKVGVASGHLPRKGSGSDCRLGHNAFSWVFSRYDQEFRFSHNGQHEPLGLLRG    281 - 350
PAQLGVVLDLQVQELLFYEPASGTVLCAHHVSFPGPLFPVFAVADQTISIVR                      351 - 402
//

Text Mined References (9)

PMID Year Title