Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.24
PubTator Score 2.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 2.82792643709156E-29
osteosarcoma 7933 4.50946127296319E-10
ovarian cancer 8492 8.16352865900866E-9
pituitary cancer 1972 7.07060385332497E-5
lung adenocarcinoma 2714 1.2524137926055E-4
ductal carcinoma in situ 1745 2.17867297852198E-4
primary pancreatic ductal adenocarcinoma 1271 7.98471336323551E-4
pancreatic cancer 2300 0.00138943161156117
sonic hedgehog group medulloblastoma 1482 0.00401767073700886
interstitial cystitis 2299 0.00495208247129948
invasive ductal carcinoma 2950 0.0173348697971857
fibroadenoma 557 0.0393798783539959
spina bifida 1064 0.0461263892141303
Disease Target Count Z-score Confidence
Parathyroid Adenoma 11 3.888 1.9

Expression

  Differential Expression (13)

Disease log2 FC p
osteosarcoma -3.135 0.000
primary pancreatic ductal adenocarcinoma -1.730 0.001
fibroadenoma 2.100 0.039
interstitial cystitis -1.200 0.005
sonic hedgehog group medulloblastoma -1.100 0.004
lung adenocarcinoma 1.200 0.000
lung carcinoma 1.300 0.000
spina bifida -1.354 0.046
ductal carcinoma in situ 2.500 0.000
invasive ductal carcinoma 1.600 0.017
ovarian cancer 1.700 0.000
pituitary cancer 1.400 0.000
pancreatic cancer -1.900 0.001

Synonym

Accession Q5W0U4 B3KS19 Q96DJ2 Q9H4E4 Q9NXN0
Symbols

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG
Horse OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (2)

PMID Text
19929093 Observational study of gene-disease association. (HuGE Navigator)
12615066 Expression analysis of the rat BSPRY ortholog and demonstration of its interaction with 14-3-3 proteins.

AA Sequence

MSAEGAEPGPGSGSGPGPGPLCPEHGQALSWFCGSERRPVCAACAGLGGRCRGHRIRRAEERAEELRNKI      1 - 70
VDQCERLQLQSAAITKYVADVLPGKNQRAVSMASAARELVIQRLSLVRSLCESEEQRLLEQVHGEEERAH     71 - 140
QSILTQRVHWAEALQKLDTIRTGLVGMLTHLDDLQLIQKEQEIFERTEEAEGILDPQESEMLNFNEKCTR    141 - 210
SPLLTQLWATAVLGSLSGTEDIRIDERTVSPFLQLSDDRKTLTFSTKKSKACADGPERFDHWPNALAATS    211 - 280
FQNGLHAWMVNVQNSCAYKVGVASGHLPRKGSGSDCRLGHNAFSWVFSRYDQEFRFSHNGQHEPLGLLRG    281 - 350
PAQLGVVLDLQVQELLFYEPASGTVLCAHHVSFPGPLFPVFAVADQTISIVR                      351 - 402
//

Text Mined References (9)

PMID Year Title
19929093 2009 Searching for genes for cleft lip and/or palate based on breakpoint analysis of a balanced translocation t(9;17)(q32;q12).
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12615066 2003 Characterization of zetin 1/rBSPRY, a novel binding partner of 14-3-3 proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11099500 2001 Interaction of the type IIa Na/Pi cotransporter with PDZ proteins.
10978534 2000 BSPRY, a novel protein of the Ro-Ret family.