Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.09

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q5W0B7 B2RXH7
Symbols FAM23A
FAM23B
bA16O1.2
bA162I21.2

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

AA Sequence

MASGRLIKFVVFELLEFAAFSIPTLVITEQFATAYQGTRARSDNTHYWLIISCSIAYVALVTLLIWVPVK      1 - 70
VILHKKRYIYRKIKGWRPVLMMCVVLTTLPCLTFSIAVTEVQKSINGSADVLPDMLPDLPVSLVLLSLIM     71 - 140
VDIIEKLRIYPLRGSQKSSENGHIHSTSLQHIKTVTEQVRQSPENAASPQATNSTQVSQPSGAMTRSQES    141 - 210
VFMGPQEPSCDSGILRMMSRRDVRAELFLWSFLLWSDTIEMVRVAGHPNVYKSSWLYPVYIFSFISLLRI    211 - 280
TFTPQNPLLNSLSVLLQDLPFVFVRLGLIIALGTITPVLGLCKNILVTLSYIYFNYLTRIRIFSAFEMSP    281 - 350
F//

Text Mined References (6)

PMID Year Title