Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.22
PubTator Score 1.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
malignant mesothelioma 3163 2.90689357238029E-6
dermatomyositis 967 0.00135972507476375
tuberculosis 1563 0.00352934912012669
sonic hedgehog group medulloblastoma 1482 0.00425734038019533
lung cancer 4473 0.00608850376663785
psoriasis 6685 0.0135800043955952
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0265274658847923

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
psoriasis -1.200 0.014
tuberculosis -1.100 0.004
intraductal papillary-mucinous neoplasm ... 1.700 0.027
lung cancer 1.200 0.006
sonic hedgehog group medulloblastoma 1.300 0.004
dermatomyositis 1.100 0.001

Synonym

Accession Q5W0B1 B2RN99 Q8TBY2 Q9H0T2 Q9H8M0
Symbols C13orf7

Gene

  Ortholog (13)

AA Sequence

MAQTVQNVTLSLTLPITCHICLGKVRQPVICINNHVFCSICIDLWLKNNSQCPACRVPITPENPCKEIIG      1 - 70
GTSESEPMLSHTVRKHLRKTRLELLHKEYEDEIDCLQKEVEELKSKNLSLESQIKTILDPLTLVQGNQNE     71 - 140
DKHLVTDNPSKINPETVAEWKKKLRTANEIYEKVKDDVDKLKEANKKLKLENGGLVRENLRLKAEVDNRS    141 - 210
PQKFGRFAVAALQSKVEQYERETNRLKKALERSDKYIEELESQVAQLKNSSEEKEAMNSICQTALSADGK    211 - 280
GSKGSEEDVVSKNQGDSARKQPGSSTSSSSHLAKPSSSRLCDTSSARQESTSKADLNCSKNKDLYQEQVE    281 - 350
VMLDVTDTSMDTYLEREWGNKPSDCVPYKDEELYDLPAPCTPLSLSCLQLSTPENRESSVVQAGGSKKHS    351 - 420
NHLRKLVFDDFCDSSNVSNKDSSEDDISRSENEKKSECFSSPKTGFWDCCSTSYAQNLDFESSEGNTIAN    421 - 490
SVGEISSKLSEKSGLCLSKRLNSIRSFEMNRTRTSSEASMDAAYLDKISELDSMMSESDNSKSPCNNGFK    491 - 560
SLDLDGLSKSSQGSEFLEEPDKLEEKTELNLSKGSLTNDQLENGSEWKPTSFFLLSPSDQEMNEDFSLHS    561 - 630
SSCPVTNEIKPPSCLFQTEFSQGILLSSSHRLFEDQRFGSSLFKMSSEMHSLHNHLQSPWSTSFVPEKRN    631 - 700
KNVNQSTKRKIQSSLSSASPSKATKS                                                701 - 726
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24262325 2014 Shared genetic susceptibility to ischemic stroke and coronary artery disease: a genome-wide analysis of common variants.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
More...