Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.77
PubTator Score 5.18

Knowledge Summary


No data available


  Disease (3)

Disease Target Count P-value
ependymoma 4679 9.8e-13
nasopharyngeal carcinoma 1058 2.6e-07
psoriasis 6694 9.2e-05
lung carcinoma 2843 7.6e-04
chronic rhinosinusitis 512 3.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Asperger syndrome 37 3.815 1.9


  Differential Expression (5)

Disease log2 FC p
chronic rhinosinusitis -1.937 3.3e-02
ependymoma 4.400 9.8e-13
lung carcinoma -1.500 7.6e-04
nasopharyngeal carcinoma -2.100 2.6e-07
psoriasis -1.700 9.2e-05


Accession Q5W041 A0PG76 A6NH64 B4DZL3 B7ZBN6 B7ZBN7 Q8IXS5 Q8N7B0 Q96M49
Symbols CT81


  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (4)

AA Sequence

LPAPEMYVIDLMFHPGGLMKLRSREADLYRFI                                          841 - 872

Text Mined References (11)

PMID Year Title