Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.87
PubTator Score 5.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.9242124668533E-22
nasopharyngeal carcinoma 1056 2.60608445377649E-7
psoriasis 6685 9.24079877104309E-5
lung carcinoma 2844 7.5679154570667E-4
chronic rhinosinusitis 512 0.0334176780947204
Disease Target Count Z-score Confidence
Asperger syndrome 35 3.728 1.9

Expression

  Differential Expression (5)

Disease log2 FC p
posterior fossa group B ependymoma 5.700 0.000
nasopharyngeal carcinoma -2.100 0.000
lung carcinoma -1.500 0.001
chronic rhinosinusitis -1.937 0.033
psoriasis -1.700 0.000

Synonym

Accession Q5W041 A0PG76 A6NH64 B4DZL3 B7ZBN6 B7ZBN7 Q8IXS5 Q8N7B0 Q96M49
Symbols CT81
KU-CT-1

Gene

PANTHER Protein Class (1)

  Ortholog (12)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG

Gene RIF (4)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16915934 ARMC3_v2 was detected in human skeletal muscle, liver, spleen and thymus; in contrast, ARMC3_v1 in skeletal muscle, lung, prostate and testis
16397042 KU-CT-1 is a new cancer testis antigen that is expressed in pancreatic, lung, and endometrial cancers
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGKKIKKEVEPPPKDVFDPLMIESKKAATVVLMLNSPEEEILAKACEAIYKFALKGEENKTTLLELGAVE      1 - 70
PLTKLLTHEDKIVRRNATMIFGILASNNDVKKLLRELDVMNSVIAQLAPEEEVVIHEFASLCLANMSAEY     71 - 140
TSKVQIFEHGGLEPLIRLLSSPDPDVKKNSMECIYNLVQDFQCRAKLQELNAIPPILDLLKSEYPVIQLL    141 - 210
ALKTLGVIANDKESRTMLRDNQGLDHLIKILETKELNDLHIEALAVIANCLEDMDTMVQIQQTGGLKKLL    211 - 280
SFAENSTIPDIQKNAAKAITKAAYDPENRKLFHEQEVEKCLVALLGSENDGTKIAASQAISAMCENSGSK    281 - 350
DFFNNQGIPQLIQLLKSDNEEVREAAALALANLTTCNPANANAAAEADGIDPLINLLSSKRDGAIANAAT    351 - 420
VLTNMAMQEPLRLNIQNHDIMHAIISPLRSANTVVQSKAALAVTATACDVEARTELRNSGGLEPLVELLR    421 - 490
SKNDEVRKHASWAVMVCAGDELTANELCRLGALDILEEVNVSGTRKNKFSEAAYNKLLNNNLSLKYSQTG    491 - 560
YLSSSNIINDGFYDYGRINPGTKLLPLKELCLQEPSDLRAVLLINSKSYVSPPSSMEDKSDVGYGRSISS    561 - 630
SSSLRRSSKEKNKKNSYHFSAGFGSPIEDKSEPASGRNTVLSKSATKEKGWRKSKGKKEEEKVKEEEEVM    631 - 700
VVPKFVGEGSSDKEWCPPSDPDFSMYVYEVTKSILPITNIKEQIEDLAKYVAEKMGGKIPKEKLPDFSWE    701 - 770
LHISELKFQLKSNVIPIGHVKKGIFYHRALLFKALADRIGIGCSLVRGEYGRAWNEVMLQNDSRKGVIGG    771 - 840
LPAPEMYVIDLMFHPGGLMKLRSREADLYRFI                                          841 - 872
//

Text Mined References (11)

PMID Year Title
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16915934 2006 Cloning and expression of ARMC3_v2, a novel splicing variant of the human ARMC3 gene.
16397042 2006 A novel cancer testis antigen that is frequently expressed in pancreatic, lung, and endometrial cancers.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...