Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Type 2 diabetes mellitus 189 1.0

Synonym

Accession Q5VZV4
Symbols FAM75B
C9orf36B
SPATA31B1

Gene

 Compartment GO Term (1)

AA Sequence

MKPWWARDWALPSRGQCVCPGETNACLDAERACRECPRGLEETWDLLSQLQSLLGTHLDKGDFGQLSGPE      1 - 70
PPGEVGKRAPDGASRSSLEPMEDAAPIIYLLASPDPRIKHPQDLASTPSPGPMTTSVSSLSASQPPEPSL     71 - 140
LLERPSPKPPALFLTHHTPLILWPALLLLQKTSLLLPCGTPL                                141 - 182
//

Text Mined References (1)

PMID Year Title
15164053 2004 DNA sequence and analysis of human chromosome 9.