Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary


No data available


  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5


AA Sequence

PGLRVSGEQSLAWGLGGPSQSQKRKGDPLASRRKKKRHCSQ                                 701 - 741

Text Mined References (1)

PMID Year Title