Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q5VZR2 A6NNI5 Q5VZR3
Symbols NUTMG
FAM22G

Gene

 Compartment GO Term (1)

AA Sequence

MASNGAYPVLGPGVTVNPGTSLSVFTALPFATPSPGPTHRPPLVTAVVPPAGPLVLSAFPSTPLVAGQDG      1 - 70
RGPSGAGASNVFVQMRTEVGPVKPPQAQTLILTQAPLVWQAPGTLCGGVMCPPPLLLAAAPGVPVTSAQV     71 - 140
VGGTQACEGGWSHGLPLPPPPPAAQVAPIVSPGNAGPWPQGAHGEGSLAPSQAKARPDDSCKPKSVYENF    141 - 210
RLWQHYKPLARRHLPQSPDTEALSCFLIPVLRSLARRKPTMTLEEGLWRAMREWQHTSNFDRMIFYEMAA    211 - 280
KFLEFEAEEEMQIQKSQWMKGPQSLPPPAPPRLEPRGPPAPEVVKQPVYLPSKDGPKAPTACLPPPRPQR    281 - 350
PAETKAHLPPPRPPRPAETKVPEEIPPEVVQEYVDIMEELLGSHPGDTGEPEGQREKGKVEQPQEEDGMT    351 - 420
SDPGLLSYIDKLCSQEDFVTKVEAVIHPRFLEELLSPDPQMDFLALSQELEQEEGLTLAQLVEKRLLSLK    421 - 490
EKGCGRAAPRHGTARLDSSPSEFAAGQEAAREVPDPQQRVSVETSPPQTAAQDPQGQGRVRTGMARSEDP    491 - 560
AVLLGCQDSPRLKAVRPTSPPQDHRPTCPGLGTKDALGLPGESPVKESHGLAKGSSEETELPGMVYVVGS    561 - 630
HHRLRPWRLSQSPVPSSGLLSPGGRGPQGALQSPSAQKRGLSPSPSPASKSKKRPLFGSPSPAEKTPHPG    631 - 700
PGLRVSGEQSLAWGLGGPSQSQKRKGDPLASRRKKKRHCSQ                                 701 - 741
//

Text Mined References (1)

PMID Year Title
15164053 2004 DNA sequence and analysis of human chromosome 9.