Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary


No data available


AA Sequence

PGLRVSGEQSLAWGLGGPSQSQKRKGDPLASRRKKKRHCSQ                                 701 - 741

Text Mined References (1)

PMID Year Title
15164053 2004 DNA sequence and analysis of human chromosome 9.