Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.3e-02
Disease Target Count Z-score Confidence
Liver disease 237 0.0 0.9

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 1.3e-02

Gene RIF (1)

AA Sequence

MTKGRRFNPPSDKDGRWFPHIGLTQKTPESITSATSKEPQSPHLPRQAEGKLPPIYKVREKQAVNNQFPF      1 - 70
SVHDNRHSLENSGCYLDSGLGRKKISPDKRQHVSRNFNLWACDYVPSCLDGFSNNQISYVYKEAMVVSSF     71 - 140
RRFPRCYKEIWNAFTFLPERSYTEVLKKKPKVRFTVDKKVVSSLES                            141 - 186
//

Text Mined References (5)

PMID Year Title