Property Summary

NCBI Gene PubMed Count 20
PubMed Score 25.83
PubTator Score 8.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
malignant mesothelioma 3163 6.78778177994871E-6
psoriasis 6685 0.00125212697068669
glioblastoma 5572 0.00698873117863057
astrocytic glioma 2241 0.0132932041383603
oligodendroglioma 2849 0.0189149208101777
medulloblastoma, large-cell 6234 0.0245933684737131
ependymoma 2514 0.0417423291264398

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma -1.400 0.000
astrocytic glioma -1.700 0.013
ependymoma -1.500 0.042
oligodendroglioma -1.500 0.019
psoriasis -1.300 0.001
glioblastoma -1.100 0.007
medulloblastoma, large-cell -1.100 0.025

Synonym

Accession Q5VZM2 A8K042 Q15348 Q8N3T0 Rag B
Symbols RAGB
bA465E19.1

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
22749528 Inhibition of glutaminolysis prevents GTP loading of RagB and lysosomal translocation and subsequent activation of mTORC1.
18187620 Knockdown of Ras-related GTP binding B (RRAGB) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MEESDSEKTTEKENLGPRMDPPLGEPEGSLGWVLPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTR      1 - 70
RLGATILDRIHSLQINSSLSTYSLVDSVGNTKTFDVEHSHVRFLGNLVLNLWDCGGQDTFMENYFTSQRD     71 - 140
NIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLR    141 - 210
RLSRPLECSCFRTSIWDETLYKAWSSIVYQLIPNVQQLEMNLRNFAEIIEADEVLLFERATFLVISHYQC    211 - 280
KEQRDAHRFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLIN    281 - 350
IRNARKHFEKLERVDGPKQCLLMR                                                  351 - 374
//

Text Mined References (26)

PMID Year Title
25567906 2015 Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1.
25561175 2015 SLC38A9 is a component of the lysosomal amino acid sensing machinery that controls mTORC1.
25259925 2014 Sestrins function as guanine nucleotide dissociation inhibitors for Rag GTPases to control mTORC1 signaling.
24665060 2014 Genome-wide association study of smoking behaviours among Bangladeshi adults.
23723238 2013 A Tumor suppressor complex with GAP activity for the Rag GTPases that signal amino acid sufficiency to mTORC1.
23394946 2013 mTOR regulates lysosomal ATP-sensitive two-pore Na(+) channels to adapt to metabolic state.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22980980 2012 Ragulator is a GEF for the rag GTPases that signal amino acid levels to mTORC1.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22749528 2012 Glutaminolysis activates Rag-mTORC1 signaling.
More...