Property Summary

NCBI Gene PubMed Count 20
Grant Count 10
R01 Count 7
Funding $1,874,676.75
PubMed Score 25.83
PubTator Score 8.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma -1.400 0.000
astrocytic glioma -1.700 0.013
ependymoma -1.500 0.042
oligodendroglioma -1.500 0.019
psoriasis -1.300 0.001
glioblastoma -1.100 0.007
medulloblastoma, large-cell -1.100 0.025

Gene RIF (2)

PMID Text
22749528 Inhibition of glutaminolysis prevents GTP loading of RagB and lysosomal translocation and subsequent activation of mTORC1.
18187620 Knockdown of Ras-related GTP binding B (RRAGB) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MEESDSEKTTEKENLGPRMDPPLGEPEGSLGWVLPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTR      1 - 70
RLGATILDRIHSLQINSSLSTYSLVDSVGNTKTFDVEHSHVRFLGNLVLNLWDCGGQDTFMENYFTSQRD     71 - 140
NIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLR    141 - 210
RLSRPLECSCFRTSIWDETLYKAWSSIVYQLIPNVQQLEMNLRNFAEIIEADEVLLFERATFLVISHYQC    211 - 280
KEQRDAHRFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLIN    281 - 350
IRNARKHFEKLERVDGPKQCLLMR                                                  351 - 374
//

Text Mined References (26)

PMID Year Title
25567906 2015 Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1.
25561175 2015 SLC38A9 is a component of the lysosomal amino acid sensing machinery that controls mTORC1.
25259925 2014 Sestrins function as guanine nucleotide dissociation inhibitors for Rag GTPases to control mTORC1 signaling.
24665060 2014 Genome-wide association study of smoking behaviours among Bangladeshi adults.
23723238 2013 A Tumor suppressor complex with GAP activity for the Rag GTPases that signal amino acid sufficiency to mTORC1.
23394946 2013 mTOR regulates lysosomal ATP-sensitive two-pore Na(+) channels to adapt to metabolic state.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22980980 2012 Ragulator is a GEF for the rag GTPases that signal amino acid levels to mTORC1.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22749528 2012 Glutaminolysis activates Rag-mTORC1 signaling.
More...