Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.07
PubTator Score 0.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
active Crohn's disease 1.058 1.1e-02
adult high grade glioma -1.500 9.8e-03
astrocytic glioma -2.000 6.8e-03
Astrocytoma, Pilocytic -1.400 8.3e-04
atypical teratoid / rhabdoid tumor -2.000 3.8e-06
Chronic Lymphocytic Leukemia 1.190 5.3e-03
cutaneous lupus erythematosus 1.300 1.4e-03
ependymoma -2.100 1.2e-02
glioblastoma -1.100 1.4e-03
malignant mesothelioma 1.300 1.2e-06
medulloblastoma -1.700 3.7e-04
medulloblastoma, large-cell -1.800 9.0e-03
oligodendroglioma -1.600 2.7e-02
osteosarcoma -1.457 4.1e-05
Pick disease -1.400 1.8e-02
pituitary cancer 1.200 3.2e-05
primitive neuroectodermal tumor -1.500 1.1e-02

AA Sequence

MACEPQVDPGATGPLPPSSPGWSALPGGSPPGWGQELHNGQVLTVLRIDNTCAPISFDLGAAEEQLQTWG      1 - 70
IQVPADQYRSLAESALLEPQVRRYIIYNSRPMRLAFAVVFYVVVWANIYSTSQMFALGNHWAGMLLVTLA     71 - 140
AVSLTLTLVLVFERHQKKANTNTDLRLAAANGALLRHRVLLGVTDTVEGCQSVIQLWFVYFDLENCVQFL    141 - 210
SDHVQEMKTSQESLLRSRLSQLCVVMETGVSPATAEGPENLEDAPLLPGNSCPNERPLMQTELHQLVPEA    211 - 280
EPEEMARQLLAVFGGYYIRLLVTSQLPQAMGTRHTNSPRIPCPCQLIEAYILGTGCCPFLAR            281 - 342
//

Text Mined References (13)

PMID Year Title