Property Summary

NCBI Gene PubMed Count 19
PubMed Score 14.56
PubTator Score 12.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adult high grade glioma -1.300 1.2e-03
astrocytic glioma 1.100 8.7e-03
Atopic dermatitis 1.100 2.0e-02
atypical teratoid / rhabdoid tumor -2.000 1.8e-05
Breast cancer -1.100 2.7e-05
dermatomyositis -1.900 8.3e-04
Down syndrome 1.600 4.7e-03
ependymoma 1.200 9.2e-03
fascioscapulohumeral muscular dystrophy 1.079 6.8e-03
Gaucher disease type 1 -1.100 3.4e-02
glioblastoma -1.400 2.6e-06
group 3 medulloblastoma -1.100 7.9e-03
hereditary spastic paraplegia -1.068 8.3e-03
lung adenocarcinoma -1.300 4.3e-10
lung cancer -1.300 9.0e-04
medulloblastoma, large-cell -2.800 5.4e-05
non-small cell lung cancer -1.017 4.7e-15
oligodendroglioma -1.300 7.8e-12
osteosarcoma 2.287 1.3e-05
ovarian cancer -1.400 1.1e-05
Pick disease -1.300 1.1e-02
primitive neuroectodermal tumor -1.800 1.7e-04
progressive supranuclear palsy -1.500 2.0e-02
psoriasis -1.300 8.5e-04

Protein-protein Interaction (1)

Gene RIF (8)

AA Sequence

MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGRCSRENCKYLH      1 - 70
PPTHLKTQLEINGRNNLIQQKTAAAMLAQQMQFMFPGTPLHPVPTFPVGPAIGTNTAISFAPYLAPVTPG     71 - 140
VGLVPTEILPTTPVIVPGSPPVTVPGSTATQKLLRTDKLEVCREFQRGNCARGETDCRFAHPADSTMIDT    141 - 210
SDNTVTVCMDYIKGRCMREKCKYFHPPAHLQAKIKAAQHQANQAAVAAQAAAAAATVMAFPPGALHPLPK    211 - 280
RQALEKSNGTSAVFNPSVLHYQQALTSAQLQQHAAFIPTGSVLCMTPATSIDNSEIISRNGMECQESALR    281 - 350
ITKHCYCTYYPVSSSIELPQTAC                                                   351 - 373
//

Text Mined References (20)

PMID Year Title