Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.70
PubTator Score 0.25

Knowledge Summary

Patent

No data available

AA Sequence

MGDLWLFLLLPLSAFHGVKGCLECDPKFIEDVGSLLGNLIPSEVPGRTQLLERQIKEMIHLSFKVSHSDK      1 - 70
RLRVLAVQQVVKLRTWLKNEFYKLGNETWKGVFIYQGKLLDVCQNLESKLKELLKNFSEIACSEDCIVVE     71 - 140
GPILDCWTCLRMTNRCFKGEYCGDEDPRKAENREIALFLILLATAVILGSAVLLFHFCIFHRRKMKAIRR    141 - 210
SLKEYVEKKLEELMGKIDEKEEKDFRLRK                                             211 - 239
//

Text Mined References (3)

PMID Year Title
22957301 2012 Positive Selection and the Evolution of izumo Genes in Mammals.
19658160 2009 Izumo is part of a multiprotein family whose members form large complexes on mammalian sperm.
15164053 2004 DNA sequence and analysis of human chromosome 9.