Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.00
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Azoospermia 110 3.253 1.6

AA Sequence

MGDLWLFLLLPLSAFHGVKGCLECDPKFIEDVGSLLGNLIPSEVPGRTQLLERQIKEMIHLSFKVSHSDK      1 - 70
RLRVLAVQQVVKLRTWLKNEFYKLGNETWKGVFIYQGKLLDVCQNLESKLKELLKNFSEIACSEDCIVVE     71 - 140
GPILDCWTCLRMTNRCFKGEYCGDEDPRKAENREIALFLILLATAVILGSAVLLFHFCIFHRRKMKAIRR    141 - 210
SLKEYVEKKLEELMGKIDEKEEKDFRLRK                                             211 - 239
//

Text Mined References (3)

PMID Year Title