Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 7.78568618894674E-19
atypical teratoid / rhabdoid tumor 4369 2.10808848070428E-13
pediatric high grade glioma 2712 2.02208788166916E-9
group 3 medulloblastoma 2254 4.79524650707658E-8
glioblastoma 5572 8.97329428971631E-7
medulloblastoma, large-cell 6234 1.01668779145853E-6
Pick disease 1893 1.83107107781931E-6
primitive neuroectodermal tumor 3031 4.37825725531721E-6
pilocytic astrocytoma 3086 4.10293492401018E-5
progressive supranuclear palsy 674 0.00767821441462425
subependymal giant cell astrocytoma 2287 0.00864127106646626

Expression

Synonym

Accession Q5VZ66 A6PW00 Q69YM6 Q6ZT29
Symbols NECC2
Jamip3
C10orf14
C10orf39
bA140A10.5

Gene

  Ortholog (9)

Gene RIF (1)

PMID Text
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSKRGMSSRAKGDKAEALAALQAANEDLRAKLTDIQIELQQEKSKVSKVEREKNQELRQVREHEQHKTAV      1 - 70
LLTELKTKLHEEKMKELQAVRETLLRQHEAELLRVIKIKDNENQRLQALLSALRDGGPEKVKTVLLSEAK     71 - 140
EEAKKGFEVEKVKMQQEISELKGAKRQVEEALTLVIQADKIKAAEIRSVYHLHQEEITRIKKECEREIRR    141 - 210
LMEEIKFKDRAVFVLERELGVQAGHAQRLQLQKEALDEQLSQVREADRHPGSPRRELPHAAGAGDASDHS    211 - 280
GSPEQQLDEKDARRFQLKIAELSAIIRKLEDRNALLSEERNELLKRVREAESQYKPLLDKNKRLSRKNED    281 - 350
LSHALRRMENKLKFVTQENIEMRQRAGIIRRPSSLNDLDQSQDEREVDFLKLQIVEQQNLIDELSKTLET    351 - 420
AGYVKSVLERDKLLRFRKQRKKMAKLPKPVVVETFFGYDEEASLESDGSSVSYQTDRTDQTPCTPDDDLE    421 - 490
EGMAKEETELRFRQLTMEYQALQRAYALLQEQVGGTLDAEREVKTREQLQAEVQRAQARIEDLEKALAEQ    491 - 560
GQDMKWIEEKQALYRRNQELVEKIKQMETEEARLRHEVQDARDQNELLEFRILELEERERKSPAISFHHT    561 - 630
PFVDGKSPLQVYCEAEGVTDIVVAELMKKLDILGDNANLTNEEQVVVIQARTVLTLAEKWLQQIEETEAA    631 - 700
LQRKMVDLESEKELFSKQKGYLDEELDYRKQALDQANKHILELEAMLYDALQQEAGAKVAELLSEEEREK    701 - 770
LKVAVEQWKRQVMSELRERDAQILRERMELLQLAQQRIKELEERIEAQKRQIKELEEKFLFLFLFFSLAF    771 - 840
ILWS                                                                      841 - 844
//

Text Mined References (9)

PMID Year Title
23144326 2012 Genome-wide association analysis of blood biomarkers in chronic obstructive pulmonary disease.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17572408 2007 Identification and characterization of two novel (neuro)endocrine long coiled-coil proteins.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15277531 2004 Jamip1 (marlin-1) defines a family of proteins interacting with janus kinases and microtubules.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.