Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.600 4.3e-05
Astrocytoma, Pilocytic -1.400 3.4e-05
atypical teratoid / rhabdoid tumor -3.000 2.1e-13
ependymoma -1.100 2.0e-02
glioblastoma -1.800 2.5e-06
group 3 medulloblastoma -2.800 4.8e-08
medulloblastoma, large-cell -2.700 1.0e-06
Pick disease -2.200 1.8e-06
primitive neuroectodermal tumor -2.000 4.4e-06
progressive supranuclear palsy -1.400 7.7e-03
subependymal giant cell astrocytoma -1.693 8.6e-03

Synonym

Accession Q5VZ66 A6PW00 Q69YM6 Q6ZT29
Symbols NECC2
Jamip3
C10orf14
C10orf39
bA140A10.5

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (1)

AA Sequence

MSKRGMSSRAKGDKAEALAALQAANEDLRAKLTDIQIELQQEKSKVSKVEREKNQELRQVREHEQHKTAV      1 - 70
LLTELKTKLHEEKMKELQAVRETLLRQHEAELLRVIKIKDNENQRLQALLSALRDGGPEKVKTVLLSEAK     71 - 140
EEAKKGFEVEKVKMQQEISELKGAKRQVEEALTLVIQADKIKAAEIRSVYHLHQEEITRIKKECEREIRR    141 - 210
LMEEIKFKDRAVFVLERELGVQAGHAQRLQLQKEALDEQLSQVREADRHPGSPRRELPHAAGAGDASDHS    211 - 280
GSPEQQLDEKDARRFQLKIAELSAIIRKLEDRNALLSEERNELLKRVREAESQYKPLLDKNKRLSRKNED    281 - 350
LSHALRRMENKLKFVTQENIEMRQRAGIIRRPSSLNDLDQSQDEREVDFLKLQIVEQQNLIDELSKTLET    351 - 420
AGYVKSVLERDKLLRFRKQRKKMAKLPKPVVVETFFGYDEEASLESDGSSVSYQTDRTDQTPCTPDDDLE    421 - 490
EGMAKEETELRFRQLTMEYQALQRAYALLQEQVGGTLDAEREVKTREQLQAEVQRAQARIEDLEKALAEQ    491 - 560
GQDMKWIEEKQALYRRNQELVEKIKQMETEEARLRHEVQDARDQNELLEFRILELEERERKSPAISFHHT    561 - 630
PFVDGKSPLQVYCEAEGVTDIVVAELMKKLDILGDNANLTNEEQVVVIQARTVLTLAEKWLQQIEETEAA    631 - 700
LQRKMVDLESEKELFSKQKGYLDEELDYRKQALDQANKHILELEAMLYDALQQEAGAKVAELLSEEEREK    701 - 770
LKVAVEQWKRQVMSELRERDAQILRERMELLQLAQQRIKELEERIEAQKRQIKELEEKFLFLFLFFSLAF    771 - 840
ILWS                                                                      841 - 844
//

Text Mined References (9)

PMID Year Title