Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
posterior fossa group B ependymoma 4.300 0.000
nasopharyngeal carcinoma -2.300 0.000
psoriasis -1.500 0.000

Synonym

Accession Q5VZ52 B7Z7I5 Q6ZQN1
Symbols C9orf18
C9orf113

Gene

PANTHER Protein Class (2)

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
20583170 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEYTGSKYIGEYVDGRMEGKAKYILPTETIYVGEMKDGMFHGEGTLYFPSGSQYDAIWENGLAIKGTYTF      1 - 70
SDGLHYDEKNWHYCDGYDRRFYTEILNGLKPAGMAQLTNMDPPRKIPKGYYDCGDGFYNPVTRVVKDYRN     71 - 140
RFLRNADDDEHEWITRTCRKG                                                     141 - 161
//

Text Mined References (6)

PMID Year Title
24665060 2014 Genome-wide association study of smoking behaviours among Bangladeshi adults.
20583170 2010 Follow-up association studies of chromosome region 9q and nonsyndromic cleft lip/palate.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.