Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ependymoma 4679 4.2e-09
nasopharyngeal carcinoma 1058 6.9e-08
psoriasis 6694 1.6e-04
Disease Target Count Z-score Confidence
Cleft Lip 141 3.674 1.8
Cleft Palate 271 3.535 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
ependymoma 3.100 4.2e-09
nasopharyngeal carcinoma -2.300 6.9e-08
psoriasis -1.500 1.6e-04

Gene RIF (1)

AA Sequence

MEYTGSKYIGEYVDGRMEGKAKYILPTETIYVGEMKDGMFHGEGTLYFPSGSQYDAIWENGLAIKGTYTF      1 - 70
SDGLHYDEKNWHYCDGYDRRFYTEILNGLKPAGMAQLTNMDPPRKIPKGYYDCGDGFYNPVTRVVKDYRN     71 - 140
RFLRNADDDEHEWITRTCRKG                                                     141 - 161
//

Text Mined References (6)

PMID Year Title