Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.83
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q5VZ46 Q5VZ45 Q9HCF8
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MEGTEAAAAKPAGGSPQGPKTGSGTASPVEGTSAVEWSGPEPQLDNGHPPRPWPCPQENRTSSLMAPQPP      1 - 70
RVWGVQLQGPSVLESKVRALKEKMTVAKQGVSPCSASQEWSSPKKPQCRRGKAGRAGTPSEGSFLPGAVV     71 - 140
APRTQNLPDGQLDGSINEEQPARDGGPRLPRPPAPGREYCNRGSPWPPEAEWTLPDHDRGPLLGPSSLQQ    141 - 210
SPIHGVTPGRPGGPGHCNKIIHIPSPRTGRSYPFPDGVVTEADLDSTSLTSEEVFVPRTALLGERWRAGD    211 - 280
LEALGAGSSVLSLSDRVERNRLLLQEMLNVSGQSPRKVGTPAWTPSWDTAAPERPVGDVDWASGTSLQDS    281 - 350
GQNRTVGPNPEPVLSPRHEEATHLLQRARMKARTRPLRASHDIVPTITQGSRDGHRSPARDPRTTPACRD    351 - 420
SLQNGHTSDSSSGESSGGHRPRRGPSPSHVRFEDESAREAEFRHLERLQQRQRQVLSTVLQAADQGPLRS    421 - 490
KPDLADYINGAPRLRDAGQGTFHRLVGSLDRRGHPAPPAPGSERRCQACGSCIDDPRPAQGKAPPVPRTL    491 - 560
QELQAACGMERVLGGLSSPLRLLPAEPRLHMEWIRETHIGDTVCPAEVDSALDSTDNSDNCRTDSEEAGT    561 - 630
SQAGWACGRTQGSSPRLRLRGSRPRGHRWSKKAEAELPWGLQAQQHLPRADDVEVENEVKEGRGHTPEGT    631 - 700
LFLREDAKPPDLELKRVSLGPQWQPGPGLGSHQPHPLDSRTPCRTAYATTAPMTPESSGPGGQAQVTESH    701 - 770
ESLEIVSPSSLQQSHAEPSAPHQAWQPTASLCPEGWAPTPPPSRKTTSPVSHRKAALAGLLRLGDQTEPV    771 - 840
GIPRPPSRSAVLRTCELPPSQTQPSRPQVRHPLLALSTNNCNNSAPRGLQEPYGGAVHEGRVERGPCSRE    841 - 910
PEPPLENSRDGGPQGFLGSADVATINSTGITLSLSSEESESSKESEGSLQRTGSGSGGHVLSRASAGAGT    911 - 980
GPGSPSAAPLDQNKKRSSSIASTLGLKKLFSALGQSSRPKLGKSRSYSVEQLQPAPPGLTSQSRAPSLQS    981 - 1050
LHPVSPSHQRRKAASFQNLHSLLSSKGNRSSLYLVAGPGDHSAAGRPAKTSPRRALSVEDVGAPSLARTV   1051 - 1120
GRLVEVFPDGTSQLQLQRSPGGTFGFCVASGNGRPDSGMPSPLPQPHGWGGLSKQGRAFWLWSEAFLVFG   1121 - 1190
//

Text Mined References (6)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12805274 2003 Identification of promoter regions in the human genome by using a retroviral plasmid library-based functional reporter gene assay.
11181995 2001 The sequence of the human genome.
10997877 2000 Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.