Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.03
PubTator Score 0.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.9e-09
breast carcinoma 1638 7.1e-05
osteosarcoma 7950 7.6e-03
pituitary cancer 1972 2.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (4)

Disease log2 FC p
breast carcinoma -1.100 7.1e-05
osteosarcoma -1.232 7.6e-03
ovarian cancer -1.100 1.9e-09
pituitary cancer 1.700 2.3e-02

Gene RIF (2)

AA Sequence

MSWNISHPQLSDKLFGKNGVLEEQKSPGFKKRETEVYVGNLPLDISKEEILYLLKDFNPLDVHKIQNGCK      1 - 70
CFAFVDLGSMQKVTLAIQELNGKLFHKRKLFVNTSKRPPKRTPDMIQQPRAPLVLEKASGEGFGKTAAII     71 - 140
QLAPKAPVDLCETEKLRAAFFAVPLEMRGSFLVLLLRECFRDLSWLALIHSVRGEAGLLVTSIVPKTPFF    141 - 210
WAMHVTEALHQNMQALFSTLAQAEEQQPYLEGSTVMRGTRCLAEYHLGDYGHAWNRCWVLDRVDTWAVVM    211 - 280
FIDFGQLATIPVQSLRSLDSDDFWTIPPLTQPFMLEKDILSSYEVVHRILKGKITGALNSAVTAPASNLA    281 - 350
VVPPLLPLGCLQQAAA                                                          351 - 366
//

Text Mined References (10)

PMID Year Title