Property Summary

NCBI Gene PubMed Count 7
PubMed Score 32.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adrenocortical carcinoma -1.507 1.3e-05
astrocytic glioma -1.200 2.9e-02
Breast cancer -1.600 3.3e-02
cystic fibrosis -2.000 3.9e-04
ductal carcinoma in situ -1.300 7.8e-04
ependymoma -1.300 1.7e-02
group 3 medulloblastoma -1.200 8.8e-03
intraductal papillary-mucinous adenoma (... -2.100 1.1e-04
intraductal papillary-mucinous carcinoma... -2.300 1.3e-04
intraductal papillary-mucinous neoplasm ... -2.400 1.7e-03
invasive ductal carcinoma -2.100 6.1e-04
lung adenocarcinoma -1.100 2.7e-10
non-small cell lung cancer -2.387 1.2e-17
oligodendroglioma -1.200 1.1e-02
osteosarcoma -1.534 4.0e-04
ovarian cancer -1.600 1.4e-10
pancreatic ductal adenocarcinoma liver m... -1.093 2.9e-03

Gene RIF (2)

AA Sequence

MQWSPTPGASACLGWASSLACSTAPTLLGRAGRGPLMAAKWFKEFPLNLKTVSERAKPGGGGGKLRKNSE      1 - 70
AGGAGPGPGKGRKNSAAELGSGRAGVGPKDSRLSRDSLQGLIQAAAGKGRKNSRATEEEPHRGATKSSGC     71 - 140
STYINRLIKVDTQEKNGKSNYPSSSSSSSSSSSSASSSPSSLGPELDKGKIIKQQETVIILEDYADPYDA    141 - 210
KRTKGQRDAERVGENDGYMEPYDAQQMITEIRRRGSKDPLVKALQLLDSPCEPADGGLKSETLAKRRSSK    211 - 280
DLLGKPPQLYDTPYEPAEGGPRAEGKARPPDSRLPENDERPAAEYEQPWEWKKEQIVRALSVQFEGAERP    281 - 350
SFREETVRQHHRQKSWTQKILKPALSDHSEGEKVDPGLPLEKQPWYHGAISRAEAESRLQPCKEAGYLVR    351 - 420
NSESGNSRYSIALKTSQGCVHIIVAQTKDNKYTLNQTSAVFDSIPEVVHYYSNEKLPFKGAEHMTLLYPV    421 - 490
HSKLH                                                                     491 - 495
//

Text Mined References (7)

PMID Year Title