Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.20
PubTator Score 0.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer -1.700 0.000
psoriasis -1.800 0.000

Gene RIF (2)

PMID Text
20949100 regulation of the Nucleoredoxin-like genes involves a CRX responsive element that can act as both as a positive regulator of promoter activity and as a modulator of cell-type specificity
18854154 Knockdown of nucleoredoxin-like 2 (NXNL2) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MVDILGERHLVTCKGATVEAEAALQNKVVALYFAAARCAPSRDFTPLLCDFYTALVAEARRPAPFEVVFV      1 - 70
SADGSSQEMLDFMRELHGAWLALPFHDPYRHELRKRYNVTAIPKLVIVKQNGEVITNKGRKQIRERGLAC     71 - 140
FQDWVEAADIFQNFSV                                                          141 - 156
//

Text Mined References (5)

PMID Year Title
20949100 2010 Expression of rod-derived cone viability factor: dual role of CRX in regulating promoter activity and cell-type specificity.
17764561 2007 Rod-derived Cone Viability Factor-2 is a novel bifunctional-thioredoxin-like protein with therapeutic potential.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.