Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.40
PubTator Score 0.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
breast carcinoma 1614 6.49373722065386E-25
non-small cell lung cancer 2798 2.5581448435079E-16
lung adenocarcinoma 2714 6.97172667965754E-13
ovarian cancer 8492 2.25057326714197E-8
osteosarcoma 7933 1.92877973191859E-6
pancreatic cancer 2300 3.12134211021961E-6
pilocytic astrocytoma 3086 9.25797539658465E-6
cystic fibrosis 1670 1.57946584546204E-5
sarcoidosis 368 4.04939570743856E-5
ulcerative colitis 2087 5.10289905211774E-5
lung carcinoma 2844 1.38681332276572E-4
pediatric high grade glioma 2712 2.52651425550972E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 3.44557215099103E-4
glioblastoma 5572 4.95766739340785E-4
primary Sjogren syndrome 789 0.00207606581152667
invasive ductal carcinoma 2950 0.00211007075161041
Breast cancer 3099 0.00304179813178628
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00304689565125327
active Crohn's disease 918 0.0055160248848988
interstitial cystitis 2299 0.00892969103315492
ductal carcinoma in situ 1745 0.00895639504697444
nasopharyngeal carcinoma 1056 0.00963697138225448
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0134933049839896
tuberculosis 1563 0.0159093545255354
astrocytic glioma 2241 0.0173859668670178
subependymal giant cell astrocytoma 2287 0.0189188849644348
mucosa-associated lymphoid tissue lymphoma 480 0.0302824320423841
spina bifida 1064 0.0303030583461835
urothelial carcinoma 318 0.0391663029619842
ependymoma 2514 0.0435857868065722

Expression

Synonym

Accession Q5VYY1 B2R9Y7 Q8WU06
Symbols

Gene

PANTHER Protein Class (3)

  Ortholog (14)

 Compartment GO Term (1)

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGILYSEPICQAAYQNDFGQVWRWVKEDSSYANVQDGFNGDTPLICACRRGHVRIVSFLLRRNANVNLKN      1 - 70
QKERTCLHYAVKKKFTFIDYLLIILLMPVLLIGYFLMVSKTKQNEALVRMLLDAGVEVNATDCYGCTALH     71 - 140
YACEMKNQSLIPLLLEARADPTIKNKHGESSLDIARRLKFSQIELMLRKAL                       141 - 191
//

Text Mined References (10)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.