Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.47
PubTator Score 0.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
active Crohn's disease 1.107 2.6e-03
active ulcerative colitis 1.058 2.1e-02
adult high grade glioma 1.300 9.7e-03
astrocytic glioma 1.700 1.7e-02
Astrocytoma, Pilocytic 2.000 1.1e-05
Breast cancer 1.100 3.0e-03
breast carcinoma 1.400 6.5e-25
cystic fibrosis 1.900 1.6e-05
ductal carcinoma in situ 2.200 9.0e-03
ependymoma 1.300 4.4e-02
glioblastoma 1.100 1.8e-03
interstitial cystitis -1.900 8.9e-03
intraductal papillary-mucinous adenoma (... 2.800 3.4e-04
intraductal papillary-mucinous carcinoma... 2.100 3.0e-03
intraductal papillary-mucinous neoplasm ... 2.200 1.3e-02
invasive ductal carcinoma 2.800 2.1e-03
lung adenocarcinoma 2.400 7.0e-13
lung carcinoma -1.200 1.4e-04
mucosa-associated lymphoid tissue lympho... 1.595 3.0e-02
nasopharyngeal carcinoma 1.300 9.6e-03
non-small cell lung cancer 2.328 2.6e-16
osteosarcoma -3.534 1.9e-06
ovarian cancer 1.500 2.3e-08
pancreatic cancer 2.200 3.1e-06
primary Sjogren syndrome 1.100 2.1e-03
sarcoidosis 1.300 1.5e-02
spina bifida -1.737 3.0e-02
subependymal giant cell astrocytoma 1.795 1.9e-02
tuberculosis 2.700 1.6e-02
urothelial carcinoma -1.400 3.9e-02

Synonym

Accession Q5VYY1 B2R9Y7 Q8WU06
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (1)

Gene RIF (2)

AA Sequence

MGILYSEPICQAAYQNDFGQVWRWVKEDSSYANVQDGFNGDTPLICACRRGHVRIVSFLLRRNANVNLKN      1 - 70
QKERTCLHYAVKKKFTFIDYLLIILLMPVLLIGYFLMVSKTKQNEALVRMLLDAGVEVNATDCYGCTALH     71 - 140
YACEMKNQSLIPLLLEARADPTIKNKHGESSLDIARRLKFSQIELMLRKAL                       141 - 191
//

Text Mined References (11)

PMID Year Title