Property Summary

NCBI Gene PubMed Count 61
PubMed Score 145.28
PubTator Score 115.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 1.9e-06
tuberculosis 2010 3.4e-06
cystic fibrosis 1696 4.7e-04
oligodendroglioma 2850 1.8e-03
astrocytic glioma 2597 3.3e-03
ependymoma 4679 5.5e-03
gastric carcinoma 807 1.4e-02
Disease Target Count Z-score Confidence
Type 1 diabetes mellitus 109 0.0 3.0
Disease Target Count Z-score Confidence
Hypertension 396 4.456 2.2
Kidney disease 430 4.19 2.1

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.400 3.3e-03
cystic fibrosis 1.164 4.7e-04
ependymoma -1.400 5.5e-03
gastric carcinoma -2.100 1.4e-02
oligodendroglioma -1.600 1.8e-03
ovarian cancer -1.100 1.9e-06
tuberculosis 1.100 3.4e-06

Gene RIF (54)

AA Sequence

MAQVLIVGAGMTGSLCAALLRRQTSGPLYLAVWDKAEDSGGRMTTACSPHNPQCTADLGAQYITCTPHYA      1 - 70
KKHQRFYDELLAYGVLRPLSSPIEGMVMKEGDCNFVAPQGISSIIKHYLKESGAEVYFRHRVTQINLRDD     71 - 140
KWEVSKQTGSPEQFDLIVLTMPVPEILQLQGDITTLISECQRQQLEAVSYSSRYALGLFYEAGTKIDVPW    141 - 210
AGQYITSNPCIRFVSIDNKKRNIESSEIGPSLVIHTTVPFGVTYLEHSIEDVQELVFQQLENILPGLPQP    211 - 280
IATKCQKWRHSQVTNAAANCPGQMTLHHKPFLACGGDGFTQSNFDGCITSALCVLEALKNYI            281 - 342
//

Text Mined References (62)

PMID Year Title