Property Summary

NCBI Gene PubMed Count 47
Grant Count 6
R01 Count 2
Funding $1,387,815.5
PubMed Score 133.35
PubTator Score 115.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.400 0.003
ependymoma -1.400 0.006
oligodendroglioma -1.600 0.002
cystic fibrosis 1.164 0.000
tuberculosis 1.100 0.000
gastric carcinoma -2.100 0.014
ovarian cancer -1.100 0.000

Gene RIF (41)

PMID Text
26716738 the antihypertensive effect of renalase still remains a phenomenon with unclear biochemical mechanim(s) and functions of intracellular and extracellular (circulating) renalases obviously differ.
26431044 marked increase of glomerular renalase and its association with macrophages suggest that it might play an important role in disease progression of LN
26049000 This article demonstrates that renalase does not catalyze the oxidation of neurotransmitter catecholamines.
25900362 Studies indicate definitive links between renalase catecholamine consumption and physiological responses.
25855559 Single nucleotide polymorphisms in nNOS, renalase, MTHFR, CELSR1 and XYLB genes were found significantly associated with ischemic stroke in Chinese patients.
25531177 the metabolic function of renalase is to oxidize isomeric NAD(P)H molecules to beta-NAD(P)(+).
25484193 An association has been found between renalase (rs2296545) CC genotype and C allele and chronic kidney disease, along with significantly high serum epinephrine level.
25380930 Renalase levels were higher in heart transplant recipients compared with healthy volunteers.
25295465 Renalase transcript levels are associated with endogenous SP1, STAT3 and ZBP89 levels.
25060760 study is the first to present reference values of urine renalase excretion in a healthy pediatric population
More...

AA Sequence

MAQVLIVGAGMTGSLCAALLRRQTSGPLYLAVWDKAEDSGGRMTTACSPHNPQCTADLGAQYITCTPHYA      1 - 70
KKHQRFYDELLAYGVLRPLSSPIEGMVMKEGDCNFVAPQGISSIIKHYLKESGAEVYFRHRVTQINLRDD     71 - 140
KWEVSKQTGSPEQFDLIVLTMPVPEILQLQGDITTLISECQRQQLEAVSYSSRYALGLFYEAGTKIDVPW    141 - 210
AGQYITSNPCIRFVSIDNKKRNIESSEIGPSLVIHTTVPFGVTYLEHSIEDVQELVFQQLENILPGLPQP    211 - 280
IATKCQKWRHSQVTNAAANCPGQMTLHHKPFLACGGDGFTQSNFDGCITSALCVLEALKNYI            281 - 342
//

Text Mined References (49)

PMID Year Title
26716738 [The history of renalase from amine oxidase to a a-NAD(P)H-oxidase/anomerase].
26431044 2015 Serum Renalase Levels Correlate with Disease Activity in Lupus Nephritis.
26049000 2015 Renalase does not catalyze the oxidation of catecholamines.
25900362 2016 The catalytic function of renalase: A decade of phantoms.
25855559 2015 Pooled genetic analysis reveals an association of SNPs of only a few genes with risk predisposition to ischemic stroke in a Chinese population.
25531177 2015 Metabolic function for human renalase: oxidation of isomeric forms of ?-NAD(P)H that are inhibitory to primary metabolism.
25484193 2015 Renalase gene polymorphism and epinephrine level in chronic kidney disease.
25380930 2014 Dopamine and noradrenaline are unrelated to renalase, heart rate, and blood pressure in heart transplant recipients.
25295465 2014 Transcriptional regulation of the novel monoamine oxidase renalase: Crucial roles of transcription factors Sp1, STAT3, and ZBP89.
25060760 2014 Normal values for urine renalase excretion in children.
More...