Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.59
PubTator Score 1.34

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
24412650 HIV-1 Vpr interacts with TSPYL1 and C20orf94 subunits of the SLX4 complex in Vpr-expressing THP-1 cells
24045615 The association of SLX4IP deletion with male sex suggest that differential illegitimate V(D)J-mediated recombination events contribute to the higher incidence rates of childhood acute lymphoblastic leukemia in boys compared with girls.
21555518 C20orf94 is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MASKKFAVKCGNFAVLVDLHILPQGSNKDTSWFSEQKKEEVCLLLKETIDSRVQEYLEVRKQHRPSNAEF      1 - 70
TRSNPLSLKGYGFQITAYFLKRGIRLRCIRSTQNAELCVFPDRFVVCVSQLAFSRDLLASQNEDLTERVL     71 - 140
HGVSDYFAECAESSLPPSAKLRRNALKEIVKRTETKSSVTSKSQTRRDTVETSSDSVIAEIARRRNDGQA    141 - 210
SSSPPSESMGQAKDSIKAAESHWGLPVQKLEKVNQTQPEDTSGQQKPHPGERLKTGLLSRSPVCSCESAS    211 - 280
PCPKQSPRVAKTQQKRRNCSSAEDFDHHGRVSLGSDRLVPREIIVEKSKAVRVLPASELSDPGLLLKQDL    281 - 350
AKTTSKEELHVLESLSSRHLMKNNPGQAQQTGLATNTERLSTIQNSPTKKRKKYERGH                351 - 408
//

Text Mined References (10)

PMID Year Title
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
24045615 2014 Frequent and sex-biased deletion of SLX4IP by illegitimate V(D)J-mediated recombination in childhood acute lymphoblastic leukemia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19596235 2009 Mammalian BTBD12/SLX4 assembles a Holliday junction resolvase and is required for DNA repair.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.