Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.60
PubTator Score 1.34

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q5VYV7 Q05CG2 Q05CT9
Symbols C20orf94
bA204H22.1
bA254M13.1
dJ1099D15.3

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MASKKFAVKCGNFAVLVDLHILPQGSNKDTSWFSEQKKEEVCLLLKETIDSRVQEYLEVRKQHRPSNAEF      1 - 70
TRSNPLSLKGYGFQITAYFLKRGIRLRCIRSTQNAELCVFPDRFVVCVSQLAFSRDLLASQNEDLTERVL     71 - 140
HGVSDYFAECAESSLPPSAKLRRNALKEIVKRTETKSSVTSKSQTRRDTVETSSDSVIAEIARRRNDGQA    141 - 210
SSSPPSESMGQAKDSIKAAESHWGLPVQKLEKVNQTQPEDTSGQQKPHPGERLKTGLLSRSPVCSCESAS    211 - 280
PCPKQSPRVAKTQQKRRNCSSAEDFDHHGRVSLGSDRLVPREIIVEKSKAVRVLPASELSDPGLLLKQDL    281 - 350
AKTTSKEELHVLESLSSRHLMKNNPGQAQQTGLATNTERLSTIQNSPTKKRKKYERGH                351 - 408
//

Text Mined References (11)

PMID Year Title