Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q5VYS4 Q8IXF1 Q96K26 Q96NC8
Symbols AWMS3
MEDA4
MEDA-4
hAWMS3
C13orf33

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MAGAACEPVARPSLTSISSGELRSLWTCDCELALLPLAQLLRLQPGAFQLSGDQLVVARPGEPAAARGGF      1 - 70
NVFGDGLVRLDGQLYRLSSYIKRYVELTNYCDYKDYRETILSKPMLFFINVQTKKDTSKERTYAFLVNTR     71 - 140
HPKIRRQIEQGMDMVISSVIGESYRLQFDFQEAVKNFFPPGNEVVNGENLSFAYEFKADALFDFFYWFGL    141 - 210
SNSVVKVNGKVLNLSSTSPEKKETIKLFLEKMSEPLIRRSSFSDRKFSVTSRGSIDDVFNCNLSPRSSLT    211 - 280
EPLLAELPFPSVLESEETPNQFI                                                   281 - 303
//

Text Mined References (7)

PMID Year Title