Property Summary

NCBI Gene PubMed Count 14
Grant Count 4
R01 Count 3
Funding $175,209.72
PubMed Score 14.52
PubTator Score 8.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
gastric cancer 1.200 0.000
Multiple myeloma 1.553 0.009
malignant mesothelioma 2.900 0.000
psoriasis -1.200 0.000
glioblastoma -2.400 0.000
osteosarcoma -1.160 0.001
ependymoma -1.500 0.000
atypical teratoid / rhabdoid tumor -2.200 0.000
medulloblastoma -1.200 0.000
medulloblastoma, large-cell -1.400 0.000
primitive neuroectodermal tumor -1.100 0.022
pediatric high grade glioma -2.000 0.000
pilocytic astrocytoma -1.900 0.000
subependymal giant cell astrocytoma -1.774 0.041
severe Alzheimer's disease -1.298 0.035
invasive ductal carcinoma -1.100 0.001
ovarian cancer -2.000 0.000
dermatomyositis 1.100 0.010

Synonym

Accession Q5VYK3 O15074 Q8WU82 Ecm29
Symbols ECM29

Gene

PANTHER Protein Class (2)

Gene RIF (4)

PMID Text
24084648 The absence of Ecm29 enhanced TLR3 signaling, which was characterized by the increased abundance of the adaptor protein and E3 ubiquitin ligase tumor necrosis factor receptor-associated factor 3
20682791 Ecm29 serves as an adaptor for coupling 26 S proteasomes to specific cellular compartments.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15496406 Ecm29 protein serves to couple the 26 S proteasome to secretory compartments engaged in quality control and to other sites of enhanced proteolysis

AA Sequence

MAAAAASASQDELNQLERVFLRLGHAETDEQLQNIISKFLPPVLLKLSSTQEGVRKKVMELLVHLNKRIK      1 - 70
SRPKIQLPVETLLVQYQDPAAVSFVTNFTIIYVKMGYPRLPVEKQCELAPTLLTAMEGKPQPQQDSLMHL     71 - 140
LIPTLFHMKYPVESSKSASPFNLAEKPKTVQLLLDFMLDVLLMPYGYVLNESQSRQNSSSAQGSSSNSGG    141 - 210
GSGIPQPPPGMSFYAAKRVIGDNPWTPEQLEQCKLGIVKFIEAEQVPELEAVLHLVIASSDTRHSVATAA    211 - 280
DLELKSKQSLIDWNNPAIINKMYKVYLGDIPLKTKEGAVLKPELKRDPVSTRVKLKIVPHLLRSRQAAET    281 - 350
FPANIQVVYDGLFGTNTNSKLRTLSLQFVHHICITCPEIKIKPLGPMLLNGLTKLINEYKEDPKLLSMAY    351 - 420
SAVGKLSSRMPHLFTKDIALVQQLFEALCKEEPETRLAIQEALSMMVGAYSTLEGAQRTLMEALVASYLI    421 - 490
KPEVQVRQVAVKFASTVFPSDHIPSRYLLLLAAGDPREEVHGEAQRVLRCLPGRNRKESTSEQMPSFPEM    491 - 560
VYYIQEKASHRMKTPVKYMTGTTVLPFNPAAFGEIVLYLRMCLAHSAGVVPTSQSLADMQDHAPAIGRYI    561 - 630
RTLMSSGQMAPSSSNKSGETNPVQIYIGLLQQLLAGVGGLPVMYCLLEAVSVYPEKLATKFVDKTEWIKS    631 - 700
LMNNSKEEMRELAALFYSVVVSTVSGNELKSMIEQLIKTTKDNHSPEIQHGSLLALGFTVGRYLAKKKMR    701 - 770
MSEQQDLERNADTLPDQEELIQSATETIGSFLDSTSPLLAIAACTALGEIGRNGPLPIPSEGSGFTKLHL    771 - 840
VESLLSRIPSSKETNKMKERAIQTLGYFPVGDGDFPHQKLLLQGLMDSVEAKQIELQFTIGEAITSAAIG    841 - 910
TSSVAARDAWQMTEEEYTPPAGAKVNDVVPWVLDVILNKHIISPNPHVRQAACIWLLSLVRKLSTHKEVK    911 - 980
SHLKEIQSAFVSVLSENDELSQDVASKGLGLVYELGNEQDQQELVSTLVETLMTGKRVKHEVSGETVVFQ    981 - 1050
GGALGKTPDGQGLSTYKELCSLASDLSQPDLVYKFMNLANHHAMWNSRKGAAFGFNVIATRAGEQLAPFL   1051 - 1120
PQLVPRLYRYQFDPNLGIRQAMTSIWNALVTDKSMVDKYLKEILQDLVKNLTSNMWRVRESSCLALNDLL   1121 - 1190
RGRPLDDIIDKLPEIWETLFRVQDDIKESVRKAAELALKTLSKVCVKMCDPAKGAAGQRTIAALLPCLLD   1191 - 1260
KGMMSTVTEVRALSINTLVKISKSAGAMLKPHAPKLIPALLESLSVLEPQVLNYLSLRATEQEKAAMDSA   1261 - 1330
RLSAAKSSPMMETINMCLQYLDVSVLGELVPRLCELIRSGVGLGTKGGCASVIVSLTTQCPQDLTPYSGK   1331 - 1400
LMSALLSGLTDRNSVIQKSCAFAMGHLVRTSRDSSTEKLLQKLNGWYMEKEEPIYKTSCALTIHAIGRYS   1401 - 1470
PDVLKNHAKEVLPLAFLGMHEIADEEKSEKEECNLWTEVWQENVPGSFGGIRLYLQELITITQKALQSQS   1471 - 1540
WKMKAQGAIAMASIAKQTSSLVPPYLGMILTALLQGLAGRTWAGKEELLKAIACVVTACSAELEKSVPNQ   1541 - 1610
PSTNEILQAVLKECSKENVKYKIVAISCAADILKATKEDRFQEFSNIVIPLIKKNSLESSGVRTTKNEEE   1611 - 1680
NEKEKELQLEYLLGAFESLGKAWPRNAETQRCYRQELCKLMCERLKLSTWKVQLGVLQSMNAFFQGLMLL   1681 - 1750
EEEHADPEALAEILLETCKSITYSLENKTYSSVRTEALSVIELLLKKLEESKQWECLTSECRVLLIESLA   1751 - 1820
TMEPDSRPELQEKAALLKKTLENLE                                                1821 - 1845
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24084648 2013 Depletion of the 26S proteasome adaptor Ecm29 increases Toll-like receptor 3 signaling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20682791 2010 A protein interaction network for Ecm29 links the 26 S proteasome to molecular motors and endosomal components.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...