Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.61
PubTator Score 4.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 2.6e-60
diabetes mellitus 1728 3.3e-03
uncontrolled asthma 56 3.9e-02
Disease Target Count Z-score Confidence
Alopecia areata 41 3.204 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus 1.100 3.3e-03
psoriasis 1.700 2.6e-60
uncontrolled asthma 1.100 3.9e-02

Gene RIF (8)

AA Sequence

MAAAAIPALLLCLPLLFLLFGWSRARRDDPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKT      1 - 70
VTPVSPLGKKLNVTMAWKAQNPVLREVVDILTEQLLDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQ     71 - 140
FSIDGQTFLLFDSEKRMWTTVHPGARKMKEKWENDKDVAMSFHYISMGDCIGWLEDFLMGMDSTLEPSAG    141 - 210
APLAMSSGTTQLRATATTLILCCLLIILPCFILPGI                                      211 - 246
//

Text Mined References (12)

PMID Year Title