Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.15
PubTator Score 4.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (3)

Disease log2 FC p
uncontrolled asthma 1.100 0.039
diabetes mellitus 1.100 0.003
psoriasis 1.700 0.000

Gene RIF (7)

PMID Text
25212604 Human anaplastic thyroid carcinoma cells are sensitive to NK cell-mediated lysis via ULBP2/5/6 and chemoattract NK cells.
23025544 RAET1L may have an important influence on regulating the strength of the alloreactive immune response in hematologic maliganacies treated with allogeneic stem cell transplantation.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20219610 genetic polymorphism among the ethnic groups
20219610 Observational study of genotype prevalence. (HuGE Navigator)
19688209 Observational study of genotype prevalence. (HuGE Navigator)
19658097 Here, we show that a sixth gene, ULBP6/RAET1L, is a polymorphic locus that expresses a functional transcript

AA Sequence

MAAAAIPALLLCLPLLFLLFGWSRARRDDPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKT      1 - 70
VTPVSPLGKKLNVTMAWKAQNPVLREVVDILTEQLLDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQ     71 - 140
FSIDGQTFLLFDSEKRMWTTVHPGARKMKEKWENDKDVAMSFHYISMGDCIGWLEDFLMGMDSTLEPSAG    141 - 210
APLAMSSGTTQLRATATTLILCCLLIILPCFILPGI                                      211 - 246
//

Text Mined References (11)

PMID Year Title
25212604 2014 Human anaplastic thyroid carcinoma cells are sensitive to NK cell-mediated lysis via ULBP2/5/6 and chemoattract NK cells.
23025544 2012 The genotype of RAET1L (ULBP6), a ligand for human NKG2D (KLRK1), markedly influences the clinical outcome of allogeneic stem cell transplantation.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20219610 2010 Single nucleotide polymorphism analysis of the NKG2D ligand cluster on the long arm of chromosome 6: Extensive polymorphisms and evidence of diversity between human populations.
19688209 2009 Polymorphisms of NKG2D ligands: diverse RAET1/ULBP genes in northeastern Thais.
19658097 2009 ULBP6/RAET1L is an additional human NKG2D ligand.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...