Property Summary

NCBI Gene PubMed Count 14
PubMed Score 12.02
PubTator Score 7.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
acute quadriplegic myopathy 1.121 1.8e-02
astrocytic glioma -1.300 2.1e-02
dermatomyositis 1.200 4.7e-02
ductal carcinoma in situ 1.200 9.7e-04
esophageal adenocarcinoma -1.500 2.8e-02
gastric carcinoma 1.700 9.8e-03
glioblastoma 1.900 2.2e-03
group 3 medulloblastoma 1.500 3.1e-02
lung cancer -1.800 1.9e-04
nephrosclerosis 1.261 5.5e-05
oligodendroglioma -1.100 4.5e-02
osteosarcoma -1.274 1.1e-07
ovarian cancer -1.700 4.8e-05
pancreatic ductal adenocarcinoma liver m... 1.891 3.2e-02
psoriasis 1.300 3.9e-04
spina bifida -1.492 4.2e-02

Gene RIF (7)

AA Sequence

MEFKLEAHRIVSISLGKIYNSRVQRGGIKLHKNLLVSLVLRSARQVYLSDPCPGLYLAGPAGTPAPPPQQ      1 - 70
QPGEPAAGPPAGWGEPPPPAARASWPETEPQPERSSVSDAPRVGDEVPVATVTGVGDVFQGGEADATEAA     71 - 140
WSRVEGPRQAAAREAEGTAGGWGVFPEVSRAARRPCGCPLGGEDPPGTPAATPRAACCCAPQPAEDEPPA    141 - 210
PPAVCPRKRCAAGVGGGPAGCPAPGSTPLKKPRRNLEQPPSGGEDDDAEEMETGNVANLISIFGSSFSGL    211 - 280
LRKSPGGGREEEEGEESGPEAAEPGQICCDKPVLRDMNPWSTAIVAF                           281 - 327
//

Text Mined References (15)

PMID Year Title