Property Summary

NCBI Gene PubMed Count 12
PubMed Score 10.20
PubTator Score 7.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
nephrosclerosis 1.261 0.000
astrocytoma 2.000 0.001
oligodendroglioma -1.100 0.045
esophageal adenocarcinoma -1.500 0.028
psoriasis 1.300 0.000
osteosarcoma -1.274 0.000
group 3 medulloblastoma 1.500 0.031
glioblastoma 1.900 0.002
acute quadriplegic myopathy 1.121 0.018
pancreatic ductal adenocarcinoma liver m... 1.891 0.032
lung cancer -2.000 0.000
spina bifida -1.492 0.042
gastric carcinoma 1.700 0.010
ductal carcinoma in situ 1.200 0.001
ovarian cancer 2.500 0.000
dermatomyositis 1.200 0.047

Synonym

Accession Q5VY09 B2RBV3 Q8WY68 Q9NY49 Q9NZP9
Symbols SBBI48

Gene

 Compartment GO Term (1)

Gene RIF (5)

PMID Text
25816751 IER5 functions as a positive feedback regulator of HSF1 and that this process involves PP2A/B55 and HSF1 dephosphorylation.
25355627 These observations suggest that HSF1-mediated IER5 expression is involved in the expression of chaperone genes and in recovery from thermal stress.
22132193 Transcriptional repression mediated by IER5 regulates Cdc25B expression levels via the release of NF-YB and p300 in acute myeloid leukemia.
19238419 the early radiation-induced expression of IER5 affects radiosensitivity via disturbing radiation-induced cell cycle checkpoints
11102586 Studies in rat found higher mRNA levels after waking and sleep deprivation for immediate early genes/transcription factors such as IER5

AA Sequence

MEFKLEAHRIVSISLGKIYNSRVQRGGIKLHKNLLVSLVLRSARQVYLSDPCPGLYLAGPAGTPAPPPQQ      1 - 70
QPGEPAAGPPAGWGEPPPPAARASWPETEPQPERSSVSDAPRVGDEVPVATVTGVGDVFQGGEADATEAA     71 - 140
WSRVEGPRQAAAREAEGTAGGWGVFPEVSRAARRPCGCPLGGEDPPGTPAATPRAACCCAPQPAEDEPPA    141 - 210
PPAVCPRKRCAAGVGGGPAGCPAPGSTPLKKPRRNLEQPPSGGEDDDAEEMETGNVANLISIFGSSFSGL    211 - 280
LRKSPGGGREEEEGEESGPEAAEPGQICCDKPVLRDMNPWSTAIVAF                           281 - 327
//

Text Mined References (13)

PMID Year Title
26496226 2015 Immediate-early response 5 (IER5) interacts with protein phosphatase 2A and regulates the phosphorylation of ribosomal protein S6 kinase and heat shock factor 1.
25816751 2015 HSF1 transcriptional activity is modulated by IER5 and PP2A/B55.
25355627 2015 Heat-induced expression of the immediate-early gene IER5 and its involvement in the proliferation of heat-shocked cells.
22132193 2011 Transcriptional repression of Cdc25B by IER5 inhibits the proliferation of leukemic progenitor cells through NF-YB and p300 in acute myeloid leukemia.
19238419 2009 Induced expression of the IER5 gene by gamma-ray irradiation and its involvement in cell cycle checkpoint control and survival.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...