Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
psoriasis 6694 7.4e-10
Atopic dermatitis 952 7.3e-04
cystic fibrosis 1696 1.6e-03
gastric carcinoma 807 4.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Obesity 678 0.0 0.8
Disease Target Count Z-score Confidence
Xeroderma pigmentosum group F 22 4.069 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
Atopic dermatitis 1.500 7.3e-04
cystic fibrosis 1.400 1.6e-03
gastric carcinoma -1.100 4.4e-02
psoriasis 1.200 7.4e-10

AA Sequence

MTDTSVLDQWKASFFVEDFLEKKTITRMVTQINCEFEEVVPSSNPDSQIEVEEVSLYTHMDYNEVFTPVS      1 - 70
CLEKCSALQNQNQDLFIDDKGILFVSSRKHLPTLPTLLSRLKLFLVKDPLLDFKGQIFTEANFSRECFSL     71 - 140
QETLEAFVKEDFCMDKVNFCQEKLEDTICLNEPSSFLIEYEFLIPPSLKPEIDIPSLSELKELLNPVPEI    141 - 210
INYVDEKEKLFERDLTNKHGIEDIGDIKFSSTEILTIQSQSEPEECSKPGELEMPLTPLFLTCQHSSVNS    211 - 280
LRTELQTFPLSPVCKINLLTAEESANEYYMMWQLERCRSPLNPFLLTVPRIQEPHSQYSVTDLKKIFSVK    281 - 350
EESLVINLEKAEWWKQAGLNLKMMETLEHLNTYLCHDNLSSNDTKIEIFLPTKVLQLESCLEHKSHSSPI    351 - 420
ALIDEKSTNAHLSLPQKSPSLAKEVPDLCFSDDYFSDKGAAKEEKPKNDQEPVNRIIQKKENNDHFELDC    421 - 490
TGPSIKSPSSSIIKKASFEHGKKQENDLDLLSDFIMLRNKYKTCTSKTEVTNSDEKHDKEACSLTLQEES    491 - 560
PIVHINKTLEEINQERGTDSVIEIQASDSQCQAFCLLEAAASPILKNLVSLCTLPTANWKFATVIFDQTR    561 - 630
FLLKEQEKVVSDAVRQGTIDEREMTFKHAALLHLLVTIRDVLLTCSLDTALGYLSKAKDIYNSILGPYLG    631 - 700
DIWRQLEIVQFIRGKKPETNYKIQELQCQILSWMQSQQQIKVLIIIRMDSDGEKHFLIKILNKIEGLTLT    701 - 770
VLHSNERKDFLESEGVLRGTSSCVVVHNQYIGADFPWSNFSFVVEYNYVEDSCWTKHCKELNIPYMAFKV    771 - 840
ILPDTVLERSTLLDRFGGFLLEIQIPYVFFASEGLLNTPDILQLLESNYNISLVERGCSESLKLFGSSEC    841 - 910
YVVVTIDEHTAIILQDLEELNYEKASDNIIMRLMALSLQYRYCWIILYTKETLNSEYLLTEKTLHHLALI    911 - 980
YAALVSFGLNSEELDVKLIIAPGVEATALIIRQIADHSLMTSKRDPHEWLDKSWLKVSPSEEEMYLLDFP    981 - 1050
CINPLVAQLMLNKGPSLHWILLATLCQLQELLPEVPEKVLKHFCSITSLFKIGSSSITKSPQISSPQENR   1051 - 1120
NQISTLSSQSSASDLDSVIQEHNEYYQYLGLGETVQEDKTTILNDNSSIMELKEISSFLPPVTSYNQTSY   1121 - 1190
WKDSSCKSNIGQNTPFLINIESRRPAYNSFLNHSDSESDVFSLGLTQMNCETIKSPTDTQKRVSVVPRFI   1191 - 1260
NSQKRRTHEAKGFINKDVSDPIFSLEGTQSPLHWNFKKNIWEQENHPFNLQYGAQQTACNKLYSQKGNLF   1261 - 1330
TDQQKCLSDESEGLTCESSKDETFWRELPSVPSLDLFRASDSNANQKEFNSLYFYQRAGKSLGQKRHHES   1331 - 1400
SFNSGDKESLTGFMCSQLPQFKKRRLAYEKVPGRVDGQTRLRFF                             1401 - 1444
//

Text Mined References (7)

PMID Year Title