Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.28
PubTator Score 11.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.500 0.011
ependymoma -1.400 0.031
oligodendroglioma -1.600 0.048
glioblastoma -2.300 0.000
osteosarcoma -1.367 0.006
medulloblastoma -2.700 0.000
atypical teratoid / rhabdoid tumor -2.500 0.000
medulloblastoma, large-cell -3.900 0.000
primitive neuroectodermal tumor -1.800 0.000
adult high grade glioma -1.800 0.000
pilocytic astrocytoma -1.200 0.000
ovarian cancer -1.400 0.000

AA Sequence

MSILLPNMAEFDTISELEEEEEEEAATSSSSPSSSSSVSGPDDDEEDEEEEEEEEEEEEEEEEEEEEEAP      1 - 70
PPPRVVSEEHLRRYAPDPVLVRGAGHITVFGLSNKFDTEFPSVLTGKVAPEEFKTSIGRVNACLKKALPV     71 - 140
NVKWLLCGCLCCCCTLGCSLWPVICLNKRTRRSIQKLIEWENNRLYHKLALHWKLTKRKCETSNMMEYVI    141 - 210
LIEFLPKYPIFRPD                                                            211 - 224
//

Text Mined References (6)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11257495 2001 A new family of small, palmitoylated, membrane-associated proteins, characterized by the presence of a cysteine-rich hydrophobic motif.
9321471 1997 Localization and expression analysis of a novel conserved brain expressed transcript, Brx/BRX, lying within the Xic/XIC candidate region.