Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.28
PubTator Score 11.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
medulloblastoma 1524 3.39324929216482E-10
atypical teratoid / rhabdoid tumor 4369 1.09184099050195E-8
glioblastoma 5572 2.07563054131892E-8
medulloblastoma, large-cell 6234 2.64509535905631E-6
primitive neuroectodermal tumor 3031 1.04982993669863E-4
pilocytic astrocytoma 3086 2.4448812835243E-4
adult high grade glioma 2148 3.51460555041523E-4
ovarian cancer 8492 3.54937069278523E-4
osteosarcoma 7933 0.00642958577076791
astrocytic glioma 2241 0.0107828397641923
ependymoma 2514 0.031373754506953
oligodendroglioma 2849 0.0484294115941293

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.500 0.011
ependymoma -1.400 0.031
oligodendroglioma -1.600 0.048
glioblastoma -2.300 0.000
osteosarcoma -1.367 0.006
medulloblastoma -2.700 0.000
atypical teratoid / rhabdoid tumor -2.500 0.000
medulloblastoma, large-cell -3.900 0.000
primitive neuroectodermal tumor -1.800 0.000
adult high grade glioma -1.800 0.000
pilocytic astrocytoma -1.200 0.000
ovarian cancer -1.400 0.000

Synonym

Accession Q5VXU3 A0PJZ2 B0QZ87 B9EGS5 Q5CZ84
Symbols BRX

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG
Fruitfly EggNOG Inparanoid

AA Sequence

MSILLPNMAEFDTISELEEEEEEEAATSSSSPSSSSSVSGPDDDEEDEEEEEEEEEEEEEEEEEEEEEAP      1 - 70
PPPRVVSEEHLRRYAPDPVLVRGAGHITVFGLSNKFDTEFPSVLTGKVAPEEFKTSIGRVNACLKKALPV     71 - 140
NVKWLLCGCLCCCCTLGCSLWPVICLNKRTRRSIQKLIEWENNRLYHKLALHWKLTKRKCETSNMMEYVI    141 - 210
LIEFLPKYPIFRPD                                                            211 - 224
//

Text Mined References (6)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11257495 2001 A new family of small, palmitoylated, membrane-associated proteins, characterized by the presence of a cysteine-rich hydrophobic motif.
9321471 1997 Localization and expression analysis of a novel conserved brain expressed transcript, Brx/BRX, lying within the Xic/XIC candidate region.