Property Summary

NCBI Gene PubMed Count 19
PubMed Score 18.39
PubTator Score 7.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
acute myeloid leukemia -2.800 2.9e-02
adult high grade glioma -3.300 3.7e-05
astrocytic glioma -2.500 2.5e-02
Astrocytoma, Pilocytic -4.400 2.4e-12
atypical teratoid / rhabdoid tumor -3.600 1.7e-05
ependymoma -3.300 4.4e-03
glioblastoma -3.600 8.0e-09
group 3 medulloblastoma -2.800 1.8e-04
lung carcinoma 3.800 4.0e-15
medulloblastoma, large-cell -4.200 8.0e-07
non primary Sjogren syndrome sicca -1.200 2.4e-02
non-small cell lung cancer 1.162 2.7e-06
oligodendroglioma -1.700 2.5e-02
osteosarcoma -1.836 1.2e-03
primitive neuroectodermal tumor -2.400 1.7e-02
psoriasis -1.100 2.8e-18
subependymal giant cell astrocytoma -2.671 4.9e-03

Gene RIF (8)

AA Sequence

MGYCSGRCTLIFICGMQLVCVLERQIFDFLGYQWAPILANFVHIIIVILGLFGTIQYRPRYITGYAVWLV      1 - 70
LWVTWNVFVICFYLEAGDLSKETDLILTFNISMHRSWWMENGPGCTVTSVTPAPDWAPEDHRYITVSGCL     71 - 140
LEYQYIEVAHSSLQIVLALAGFIYACYVVKCITEEEDSFDFIGGFDSYGYQGPQKTSHLQLQPMYMSK      141 - 208
//

Text Mined References (21)

PMID Year Title