Property Summary

NCBI Gene PubMed Count 18
PubMed Score 15.43
PubTator Score 7.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
ependymoma 2514 5.46795695080228E-21
psoriasis 6685 2.84449731961165E-18
lung carcinoma 2844 4.03767229720619E-15
oligodendroglioma 2849 8.1420975901082E-13
pilocytic astrocytoma 3086 2.91852002263027E-12
group 4 medulloblastoma 1875 4.79889909630942E-11
pediatric high grade glioma 2712 6.08709191465626E-10
atypical teratoid/rhabdoid tumor 1095 6.59740221576387E-8
medulloblastoma, large-cell 6234 8.00482616555008E-7
glioblastoma 5572 1.17821977674492E-6
non-small cell lung cancer 2798 2.71472631812927E-6
osteosarcoma 7933 0.00123531693976775
subependymal giant cell astrocytoma 2287 0.00490629685499225
primitive neuroectodermal tumor 3031 0.0166736884462356
non primary Sjogren syndrome sicca 840 0.0240178228536346
astrocytic glioma 2241 0.0248831958903084
acute myeloid leukemia 785 0.028612416725268
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 1.0
Cognitive disorder 44 0.0 2.0
Disease Target Count Z-score Confidence
Genital herpes 10 3.305 1.7

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -2.500 0.025
ependymoma -4.000 0.000
oligodendroglioma -2.500 0.000
glioblastoma -3.800 0.000
osteosarcoma -1.836 0.001
group 4 medulloblastoma -4.400 0.000
atypical teratoid/rhabdoid tumor -3.800 0.000
medulloblastoma, large-cell -4.200 0.000
primitive neuroectodermal tumor -2.400 0.017
non-small cell lung cancer 1.162 0.000
pediatric high grade glioma -4.000 0.000
pilocytic astrocytoma -4.300 0.000
non primary Sjogren syndrome sicca -1.200 0.024
subependymal giant cell astrocytoma -2.671 0.005
lung carcinoma 3.800 0.000
acute myeloid leukemia -2.800 0.029
psoriasis -1.100 0.000

Gene

  Ortholog (3)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (7)

PMID Text
24205241 High levels of NKAIN2 were detected in the MYCN-amplified NB cell lines.
20634892 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
15908570 It is concluded that germline alterations of the TCBA1 gene are associated with developmental delay and typical physical features.
11979551 T-cell lymphoma breakpoint associated target 1 is a possible target gene for T-cell lineage-specific chromosome aberrations at 6q21.

AA Sequence

MGYCSGRCTLIFICGMQLVCVLERQIFDFLGYQWAPILANFVHIIIVILGLFGTIQYRPRYITGYAVWLV      1 - 70
LWVTWNVFVICFYLEAGDLSKETDLILTFNISMHRSWWMENGPGCTVTSVTPAPDWAPEDHRYITVSGCL     71 - 140
LEYQYIEVAHSSLQIVLALAGFIYACYVVKCITEEEDSFDFIGGFDSYGYQGPQKTSHLQLQPMYMSK      141 - 208
//

Text Mined References (20)

PMID Year Title
24999842 2014 Genome-wide association study of celiac disease in North America confirms FRMD4B as new celiac locus.
24569950 2014 Genetic influences on political ideologies: twin analyses of 19 measures of political ideologies from five democracies and genome-wide findings from three populations.
24205241 2013 High-resolution array CGH profiling identifies Na/K transporting ATPase interacting 2 (NKAIN2) as a predisposing candidate gene in neuroblastoma.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23894747 2013 A comprehensive family-based replication study of schizophrenia genes.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
23534349 2013 Generalization of variants identified by genome-wide association studies for electrocardiographic traits in African Americans.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
20634892 2010 A genome-wide association study of neuroticism in a population-based sample.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...