Property Summary

NCBI Gene PubMed Count 18
PubMed Score 15.43
PubTator Score 7.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -2.500 0.025
ependymoma -4.000 0.000
oligodendroglioma -2.500 0.000
glioblastoma -3.800 0.000
osteosarcoma -1.836 0.001
group 4 medulloblastoma -4.400 0.000
atypical teratoid/rhabdoid tumor -3.800 0.000
medulloblastoma, large-cell -4.200 0.000
primitive neuroectodermal tumor -2.400 0.017
non-small cell lung cancer 1.162 0.000
pediatric high grade glioma -4.000 0.000
pilocytic astrocytoma -4.300 0.000
non primary Sjogren syndrome sicca -1.200 0.024
subependymal giant cell astrocytoma -2.671 0.005
lung carcinoma 3.800 0.000
acute myeloid leukemia -2.800 0.029
psoriasis -1.100 0.000

Gene RIF (7)

PMID Text
24205241 High levels of NKAIN2 were detected in the MYCN-amplified NB cell lines.
20634892 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
15908570 It is concluded that germline alterations of the TCBA1 gene are associated with developmental delay and typical physical features.
11979551 T-cell lymphoma breakpoint associated target 1 is a possible target gene for T-cell lineage-specific chromosome aberrations at 6q21.

AA Sequence

MGYCSGRCTLIFICGMQLVCVLERQIFDFLGYQWAPILANFVHIIIVILGLFGTIQYRPRYITGYAVWLV      1 - 70
LWVTWNVFVICFYLEAGDLSKETDLILTFNISMHRSWWMENGPGCTVTSVTPAPDWAPEDHRYITVSGCL     71 - 140
LEYQYIEVAHSSLQIVLALAGFIYACYVVKCITEEEDSFDFIGGFDSYGYQGPQKTSHLQLQPMYMSK      141 - 208
//

Text Mined References (20)

PMID Year Title
24999842 2014 Genome-wide association study of celiac disease in North America confirms FRMD4B as new celiac locus.
24569950 2014 Genetic influences on political ideologies: twin analyses of 19 measures of political ideologies from five democracies and genome-wide findings from three populations.
24205241 2013 High-resolution array CGH profiling identifies Na/K transporting ATPase interacting 2 (NKAIN2) as a predisposing candidate gene in neuroblastoma.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23894747 2013 A comprehensive family-based replication study of schizophrenia genes.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
23534349 2013 Generalization of variants identified by genome-wide association studies for electrocardiographic traits in African Americans.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
20634892 2010 A genome-wide association study of neuroticism in a population-based sample.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...