Tbio | Synaptophysin-like protein 2 |
Involved in communication between the T-tubular and junctional sarcoplasmic reticulum (SR) membranes.
Comments
Disease | Target Count | P-value |
---|---|---|
psoriasis | 6685 | 4.88677129689478E-49 |
group 3 medulloblastoma | 2254 | 9.12546709602406E-4 |
subependymal giant cell astrocytoma | 2287 | 0.0300670338090859 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Kidney disease | 397 | 0.0 | 2.0 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Central core myopathy | 7 | 3.373 | 1.7 |
Disease | log2 FC | p |
---|---|---|
group 3 medulloblastoma | -1.500 | 0.001 |
subependymal giant cell astrocytoma | 1.021 | 0.030 |
psoriasis | -2.700 | 0.000 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Mouse | OMA Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG |
Cow | OMA EggNOG |
Opossum | OMA EggNOG Inparanoid |
Platypus | OMA EggNOG |
Anole lizard | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
MSSTESAGRTADKSPRQQVDRLLVGLRWRRLEEPLGFIKVLQWLFAIFAFGSCGSYSGETGAMVRCNNEA 1 - 70 KDVSSIIVAFGYPFRLHRIQYEMPLCDEESSSKTMHLMGDFSAPAEFFVTLGIFSFFYTMAALVIYLRFH 71 - 140 NLYTENKRFPLVDFCVTVSFTFFWLVAAAAWGKGLTDVKGATRPSSLTAAMSVCHGEEAVCSAGATPSMG 141 - 210 LANISVLFGFINFFLWAGNCWFVFKETPWHGQGQGQDQDQDQDQGQGPSQESAAEQGAVEKQ 211 - 272 //
PMID | Year | Title |
---|---|---|
25406998 | 2015 | Exome sequencing followed by genotyping suggests SYPL2 as a susceptibility gene for morbid obesity. |
22926577 | 2012 | Quantitative proteomic analysis of human substantia nigra in Alzheimer's disease, Huntington's disease and Multiple sclerosis. |
22290180 | 2012 | Mitsugumin 29 is transcriptionally induced in senile plaque-associated astrocytes. |
20383146 | 2010 | New loci associated with kidney function and chronic kidney disease. |
20125088 | 2011 | Genome-wide association study of recurrent early-onset major depressive disorder. |
16710414 | 2006 | The DNA sequence and biological annotation of human chromosome 1. |
16344560 | 2006 | Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. |
14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. |
12975309 | 2003 | The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. |
12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. |