Property Summary

NCBI Gene PubMed Count 10
Grant Count 7
R01 Count 6
Funding $651,146.58
PubMed Score 23.11
PubTator Score 7.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma -1.500 0.001
subependymal giant cell astrocytoma 1.021 0.030
psoriasis -2.700 0.000

 GO Function (1)

Gene RIF (2)

PMID Text
25406998 SYPL2 is a susceptibility gene for morbid obesity.
22290180 Mitsugumin (MG)29 is expressed in astrocytes of Alzheimer disease brains associated with senile plaques, but is is not expressed in neurons around lesions.

AA Sequence

MSSTESAGRTADKSPRQQVDRLLVGLRWRRLEEPLGFIKVLQWLFAIFAFGSCGSYSGETGAMVRCNNEA      1 - 70
KDVSSIIVAFGYPFRLHRIQYEMPLCDEESSSKTMHLMGDFSAPAEFFVTLGIFSFFYTMAALVIYLRFH     71 - 140
NLYTENKRFPLVDFCVTVSFTFFWLVAAAAWGKGLTDVKGATRPSSLTAAMSVCHGEEAVCSAGATPSMG    141 - 210
LANISVLFGFINFFLWAGNCWFVFKETPWHGQGQGQDQDQDQDQGQGPSQESAAEQGAVEKQ            211 - 272
//

Text Mined References (10)

PMID Year Title
25406998 2015 Exome sequencing followed by genotyping suggests SYPL2 as a susceptibility gene for morbid obesity.
22926577 2012 Quantitative proteomic analysis of human substantia nigra in Alzheimer's disease, Huntington's disease and Multiple sclerosis.
22290180 2012 Mitsugumin 29 is transcriptionally induced in senile plaque-associated astrocytes.
20383146 2010 New loci associated with kidney function and chronic kidney disease.
20125088 2011 Genome-wide association study of recurrent early-onset major depressive disorder.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.