Property Summary

NCBI Gene PubMed Count 10
PubMed Score 24.68
PubTator Score 7.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
psoriasis 6694 4.9e-49
group 3 medulloblastoma 4104 9.1e-04
subependymal giant cell astrocytoma 2287 3.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Kidney disease 430 0.0 3.0
Disease Target Count Z-score Confidence
Central core myopathy 5 3.275 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma -1.500 9.1e-04
psoriasis -2.700 4.9e-49
subependymal giant cell astrocytoma 1.021 3.0e-02

 GO Function (1)

Gene RIF (2)

AA Sequence

MSSTESAGRTADKSPRQQVDRLLVGLRWRRLEEPLGFIKVLQWLFAIFAFGSCGSYSGETGAMVRCNNEA      1 - 70
KDVSSIIVAFGYPFRLHRIQYEMPLCDEESSSKTMHLMGDFSAPAEFFVTLGIFSFFYTMAALVIYLRFH     71 - 140
NLYTENKRFPLVDFCVTVSFTFFWLVAAAAWGKGLTDVKGATRPSSLTAAMSVCHGEEAVCSAGATPSMG    141 - 210
LANISVLFGFINFFLWAGNCWFVFKETPWHGQGQGQDQDQDQDQGQGPSQESAAEQGAVEKQ            211 - 272
//

Text Mined References (10)

PMID Year Title