Property Summary

NCBI Gene PubMed Count 2
PubMed Score 3.38
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
17388942 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLAEWGACLLLAVALLGPGLQAQAMEGVKCGGVLSAPSGNFSSPNFPRLYPYNTECSWLIVVAEGSSVLL      1 - 70
TFHAFDLEYHDTCSFDFLEIYNGASPDKGNLLGRFCGKVPPPPFTSSWHVMSVIFHSDKHVASHGFSAGY     71 - 140
QKDVCGGVLTGLSGVLTSPEYPNNYPNSMECHWVIRAAGPAHVKLVFVDFQVEGNEECTYDYVAVLGGPG    141 - 210
PTRGHHYCGSTRPPTLVSLGHELQVVFKSDFNIGGRGFKAYYFSGECQEVYMAMRGNFSSPQYPSSYPNN    211 - 280
IRCHWTIRLPPGYQVKVFFLDLDLEEPNSLTKTCDFDHLAAFDGASEEAPLLGNWCGHHLPPPVTSSHNQ    281 - 350
LLLLLHTDRSTTRRGFSVAYIGGQLGCGSGSTEGEGEALQPQSLQSPSSIPPVCPAPPMNGLLQLLLHWL    351 - 420
HPCPLSGPLRLDGTAPACFHYCRASFPSF                                             421 - 449
//

Text Mined References (4)

PMID Year Title
17388942 2007 Investigation of the PARK10 gene in Parkinson disease.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.