Property Summary

NCBI Gene PubMed Count 1
PubMed Score 3.78
PubTator Score 4.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Hydronephrosis 19 3.573 1.8

AA Sequence

MWQLLAAACWMLLLGSMYGYDKKGNNANPEANMNISQIISYWGYPYEEYDVTTKDGYILGIYRIPHGRGC      1 - 70
PGRTAPKPAVYLQHGLIASASNWICNLPNNSLAFLLADSGYDVWLGNSRGNTWSRKHLKLSPKSPEYWAF     71 - 140
SLDEMAKYDLPATINFIIEKTGQKRLYYVGHSQGTTIAFIAFSTNPELAKKIKIFFALAPVVTVKYTQSP    141 - 210
MKKLTTLSRRVVKVLFGDKMFHPHTLFDQFIATKVCNRKLFRRICSNFLFTLSGFDPQNLNMSRLDVYLS    211 - 280
HNPAGTSVQNMLHWAQAVNSGQLQAFDWGNSDQNMMHFHQLTPPLYNITKMEVPTAIWNGGQDIVADPKD    281 - 350
VENLLPQIANLIYYKLIPHYNHVDFYLGEDAPQEIYQDLIILMEEYLQN                         351 - 399
//

Text Mined References (2)

PMID Year Title
17562024 2007 Large-scale identification of human genes implicated in epidermal barrier function.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.